KEGG   Camelus dromedarius (Arabian camel): 105085855
Entry
105085855         CDS       T04642                                 

Gene name
ETV5
Definition
(RefSeq) ETS translocation variant 5 isoform X1
  KO
K15593  ets translocation variant 5
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk05202  Transcriptional misregulation in cancer
cdk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    105085855 (ETV5)
  09162 Cancer: specific types
   05215 Prostate cancer
    105085855 (ETV5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105085855 (ETV5)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    105085855 (ETV5)
SSDB
Motif
Pfam: ETS_PEA3_N Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 105085855
NCBI-ProteinID: XP_031308623
LinkDB
Position
1
AA seq 530 aa
MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAE
AQVPDDEQFVPDFQSDNLACSSWRSSLVISLDSSDLPQVVLHAPPPTKIKRELHSPSSEL
SSCSHEQALGANYGEKCLYNYCAYDRKPPSGFKPLTPPTTPLSPSQSSLFPPPQASLPTS
AHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQR
QLSEPCHPFPPQSGVPGDNRPNYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPG
PPAHGFQSPLGIKQEPRDYCVDSEVPNCQSSYMRGGYFSSSHEGFPYEKDPRLYFDDTCV
VPERLEGKVKQEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIE
PEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFP
DNQRPFLKAESECHLSEEDTLPLTHFEDNPAYLLDVDRCSSLPYAEGFAY
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggatgggttttatgatcaacaagtcccttttatggtcccagggaaatctcgatcagag
gagtgtagagggcggcctgtgattgacagaaagaggaagtttttggacacagatctggct
cacgattctgaagagttgtttcaggatctcagtcaacttcaagaggcttggttagctgaa
gcacaagttcctgatgatgaacagtttgtcccagattttcagtctgataacttagcatgc
tcttcctggagatcaagtctggtcatctcactggattcatcagatctccctcaggtggtg
cttcatgccccacctccaaccaagatcaaacgggagctgcacagcccctcctctgagctg
tcgtcctgcagccatgagcaggctctcggtgctaattatggagaaaagtgcctctacaac
tattgtgcctatgataggaagcctccctcggggttcaagccattaacccctcctaccacc
ccactgtcaccctcccagagttccctatttcctccaccgcaggcatcactgcccacctcg
gcacatgcccctgcagctggcccagtacaaggtgtgggccctgcccccgcccctcattca
cttccagagcctggaccacagcagcaaacctttgcggttccccggccgccacatcagccc
ctgcagatgccaaagatgatgcctgaaaaccagtatccatcagaacagagatttcagaga
caactgtctgaaccctgccaccccttccctcctcagtccggagttcctggagataatcgc
cccaattaccaccggcaaatgtcagaacctattgtccctgcagctcccccaccccctcag
ggattcaaacaagaataccatgacccactctatgaacatggggtcccaggcatgcctggc
cccccagcacatgggttccagtcaccactgggaatcaagcaggagccccgggattactgc
gttgattcagaagtgcctaactgccagtcgtcctacatgagagggggctatttctccagc
agccatgagggttttccatatgaaaaagatccccggttgtactttgacgacacttgtgtt
gttcctgagagattggaaggcaaagtcaaacaggaacccaccatgtatcgggagggaccc
ccttaccagaggcgaggttcccttcagctgtggcaattcctcgttaccctgcttgacgac
ccagccaatgcccacttcattgcctggacaggcagaggcatggagttcaagctgatagaa
cctgaggaggttgctcggcgttggggcatccagaagaaccggccggccatgaactatgac
aagctcagccgatccctacgctattactatgaaaagggcatcatgcagaaggtggctggg
gagcggtatgtctacaagtttgtctgtgaccctgatgcgcttttctccatggccttccct
gacaaccagcgtccgttcctgaaagcggagtccgagtgccacctcagcgaggaggatacc
ctgccactgacccactttgaagacaacccagcttacctcctggacgtggaccgctgcagc
agcctcccctatgccgaaggctttgcttactaa

DBGET integrated database retrieval system