KEGG   Camelus dromedarius (Arabian camel): 105085864Help
Entry
105085864         CDS       T04642                                 

Gene name
EHHADH
Definition
(RefSeq) peroxisomal bifunctional enzyme
  KO
K07514  enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00071  Fatty acid degradation
cdk00280  Valine, leucine and isoleucine degradation
cdk00310  Lysine degradation
cdk00380  Tryptophan metabolism
cdk00410  beta-Alanine metabolism
cdk00640  Propanoate metabolism
cdk00650  Butanoate metabolism
cdk01100  Metabolic pathways
cdk01200  Carbon metabolism
cdk01212  Fatty acid metabolism
cdk03320  PPAR signaling pathway
cdk04146  Peroxisome
Module
cdk_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
cdk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    105085864 (EHHADH)
   00650 Butanoate metabolism
    105085864 (EHHADH)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105085864 (EHHADH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    105085864 (EHHADH)
   00310 Lysine degradation
    105085864 (EHHADH)
   00380 Tryptophan metabolism
    105085864 (EHHADH)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105085864 (EHHADH)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105085864 (EHHADH)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105085864 (EHHADH)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     105085864 (EHHADH)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     105085864 (EHHADH)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     105085864 (EHHADH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 TrkA_N UDPG_MGDP_dh_N ApbA 2-Hacid_dh_C F420_oxidored
Motif
Other DBs
NCBI-GeneID: 105085864
NCBI-ProteinID: XP_010974473
LinkDB All DBs
Position
1
AA seq 723 aa AA seqDB search
MAEFARLQNSLALIRLRNPPVNAISLAVIRGIEEGLQKAQTDHTVKAIVICGADGIFCAG
ADISAFSTDRISDFRLGKLIDKIQRNEKPVVAAIKGVALGGGLEVALGCHYRIAHAQAQV
GLPEVTLGIIPAARGTQLLPRLIGVPAALDLITSGRHISANEALKLGILDKIVNSDPVEE
AIKMAQRVSDQSLESRRLCNRLIPNLPNMDAIFSETILRMRKQHPGCISQETSVRAVQAA
VQYPYEMGVKKVEDLYMYVQSSGQARALQYAFFAERKASKWSTPSGASWKTASAQPISSV
GVLGLGTMGRGIVVSLARAQIPVIAVESDKKQLEAANNIITSILEKEASKMQQSGHPWSG
TKPRLTTSMKELSGVDLVIEAVFEEMNLKKQVFAELSAVCKPEAFLCTNTSALDIDEIAS
STDRPHLVIGTHFFSPAHVMKLLEVIPGRYSSPTTIATVMNLSKKIKKIGVVVGNCFGFV
GNRMLKSYYNQTYFLLEEGSKPEEIDQVLEEFGFKMGPFRVSDLAGLDIGWKSRKGQGLT
GPMLPPGTPARNRDNGRYCPIPDMLCEAGRFGQKTGKGWYLYDKPLGRIHKPDPWLSKFL
TQYRETYHIEERIISQVEILERCLYSLINEAFRILGDGIAAAPEHIDVIYLHGYGWPRHK
GGPMFYASTVGLPTVLEKLQKYHMQNPDIPQLEPCDYLKKMASLGNPPLKEWQSLAGPPS
NKL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtttgcgcggctgcagaactctctggcactgatccgcctacgaaacccgccg
gtcaacgcgatcagtttggctgtaatccgtggaatagaagagggactgcagaaagcgcaa
acagaccatacagtaaaagccattgtaatttgtggagcagatggcatcttctgtgcaggt
gctgatatcagtgccttcagtacagacagaatctctgacttcagactgggaaagttaata
gataaaatacagagaaatgagaaacctgtggtggcagctatcaaaggcgtggctttggga
gggggactggaagtggctctcggctgtcactataggattgcccatgcacaggctcaagtt
ggcctcccagaagtcacactaggaatcattcctgctgcaagaggaacccagcttctcccc
agacttattggcgttcctgctgcacttgacttaatcacctcaggaagacatatttcagca
aatgaagcactgaagctgggtattctagataaaattgtgaactcagacccagttgaagaa
gcaatcaaaatggcccagagagtttcagatcaatctctagaatcccgtagactctgcaac
aggctgattccgaacttgccaaacatggatgccattttcagtgaaaccattttgaggatg
cggaaacagcaccctgggtgcatttctcaggagacttctgtccgtgcggttcaggctgcc
gtccaatatccctatgaaatgggcgtcaagaaggtggaggatctgtacatgtacgttcag
tcatcagggcaggctagagccctgcaatatgctttctttgctgagagaaaggcaagtaag
tggtccactccctccggagcatcctggaaaacagcatcggcacagcccatctcttctgtt
ggtgttctcggcttgggaacaatgggccgaggcatcgttgtttctctggcaagggcccaa
atcccagtgattgccgtagaatcagacaagaagcagctagaagctgcgaacaacataatc
acctccatcttggaaaaggaagcatccaaaatgcaacagagtggccacccttggtcagga
acaaaacccaggttaactacatctatgaaagagcttagtggtgtagatttagtcattgaa
gcagtatttgaggaaatgaacctgaagaaacaggtctttgctgaactatcagccgtgtgc
aagccagaagcatttttgtgcaccaatacttcagccctagacattgatgagattgcttct
tccactgatcgacctcacttggtcattggcacccacttcttctccccagctcatgtcatg
aagttgttagaggttattcccggccgatactcttcccccactactattgccacagttatg
aatttatcaaaaaagattaaaaaaatcggagtagttgtaggcaactgttttgggtttgtt
gggaatcgaatgttgaagtcttattacaaccagacatatttcttattagaagaaggcagt
aagccagaggagatagatcaggtgctggaagaatttggtttcaaaatgggaccttttaga
gtgtccgatcttgctgggttggatataggttggaaatctcggaaagggcaaggtcttact
ggaccgatgttgcctccaggaactcctgcccgaaaccgagacaatgggagatattgccca
attcctgatatgctctgtgaagcaggacgatttggccagaagacaggtaagggttggtac
ctttatgataagccattgggtaggattcacaaaccagatccctggctttccaaatttctg
acacagtacagagaaacctatcacattgaagagcgtatcattagccaggttgagatcctt
gagcgctgcttatattcactcatcaatgaagcattccgcatcttgggagatggcatagca
gctgccccagagcacattgatgttatctacttacatgggtatggatggccaaggcataag
ggtgggcccatgttctatgcctccacagttgggctgcccacagtgctagagaagttgcag
aaatatcacatgcagaatcctgatattccccaactggagccttgtgactatctgaaaaaa
atggcttccctgggaaaccctcctctgaaagagtggcaaagcttggcaggaccccctagc
aataaattgtga

DBGET integrated database retrieval system