KEGG   Camelus dromedarius (Arabian camel): 105085889
Entry
105085889         CDS       T04642                                 

Gene name
DVL3
Definition
(RefSeq) LOW QUALITY PROTEIN: segment polarity protein dishevelled homolog DVL-3
  KO
K02353  segment polarity protein dishevelled
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04330  Notch signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105085889 (DVL3)
   04330 Notch signaling pathway
    105085889 (DVL3)
   04390 Hippo signaling pathway
    105085889 (DVL3)
   04150 mTOR signaling pathway
    105085889 (DVL3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105085889 (DVL3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105085889 (DVL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105085889 (DVL3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105085889 (DVL3)
   05226 Gastric cancer
    105085889 (DVL3)
   05217 Basal cell carcinoma
    105085889 (DVL3)
   05224 Breast cancer
    105085889 (DVL3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105085889 (DVL3)
   05022 Pathways of neurodegeneration - multiple diseases
    105085889 (DVL3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105085889 (DVL3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105085889 (DVL3)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 105085889
NCBI-ProteinID: XP_010974505
LinkDB
Position
1
AA seq 716 aa
MGETKIIYHLDGQETPYLVKLPLPAERVTXADFKGVLQRPSYSXLFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPEPAPFCADNPSELPPPMERTGGIGDSRPPSFHPH
AGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHTTRLNGTAKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDAKAGDSKSGG
SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLASSLRSHHTHPSYGPPGVPP
LYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgggcgagacgaagatcatctaccacctggacgggcaggagacgccgtacctggtgaag
ctgcccctgcccgcggagcgcgtcaccnttgcggactttaagggcgttctgcagcgaccc
agctatagtnntctcttcaagtctatggacgacgatttcggagtggtgaaggaggagatc
tcggatgacaacgccaagcttccctgcttcaatggccgggtggtgtcctggctggtgtcg
gctgagggctcgcacccagagccagctcccttctgtgctgacaacccatcagaactgcca
ccacccatggagcgcacgggaggcattggggactcccggcccccatccttccaccctcat
gctggtgggggcagccaggagaacctggacaatgacacagagaccgactccctggtgtct
gcccagcgggagcggccacgccggagggatggccccgagcacacaacccggctaaatgga
actgcaaagggggagcggcggcgagagccagggggttatgatagctcatccacccttatg
agcagcgagttggagaccaccagcttctttgattcggatgaggatgactccaccagcagg
ttcagcagctccacagagcagagcagcgcctcacgcctgatgagaagacacaagcggcgg
cggcggaagcagaaggtttcgaggattgagcggtcctcgtccttcagcagcatcacggac
tccaccatgtcactcaacatcatcacagtcactctcaacatggaaaagtataacttcttg
ggcatctccattgtgggccaaagcaacgagcgtggtgacggaggcatctacattggctct
atcatgaagggtggggccgtggctgctgatggacgcatcgagccaggagatatgctccta
caggtaaatgagatcaactttgagaacatgagtaatgacgacgcggtccgggtactgcgg
gagattgtgcacaaaccagggcccatcaccttgactgtagccaagtgctgggacccaagt
ccacgtggttgcttcacattacccaggagtgagcccatccggcccattgaccccgcagcc
tgggtctcccatactgcagccatgaccggcaccttccctgcctacggcatgagcccttcc
ctgagcaccatcacctccaccagctcctccatcaccagctccatccctgacacagagcgc
ctagatgacttccacctgtccatccacagtgacatggccgccatcgtaaaagccatggcc
tcccctgaatccgggctggaggtccgtgaccgcatgtggctcaagattactatccccaac
gctttcatcggctcagatgtggtggactggctgtaccacaacgtcgaaggcttcactgac
cggcgagaggcccgcaagtatgccagcaacctgctgaaagccggtttcatccgccacact
gtcaacaagatcaccttctccgagcagtgctactacatctttggcgacctctgtggcaac
atggccaacctctccctccacgatcatgatggctccagcggtgcctctgatcaggacaca
ctggcccctctgccgcatccgggggccgccccttggcccatggctttcccttaccagtac
ccgcctcccccgcacccctacaacccacacccaggtttcccggagctggggtacagctat
ggcgggggcagcgccagcagtcagcacagtgaaggcagccgaagcagtggctccaaccgc
agcggcagcgaccggcggaaggagaaggacgcgaaggccggggactcgaagtccggcggc
agtggcagcgagtcggaccacacgacccgcagcagtctgcgggggccgcgggagcgggca
cccagcgagcgctcgggtcctgccgccagcgagcacagccaccgcagccaccactcgctg
gccagcagcctgcgcagccatcacacgcatccgagctatggcccccctggagtgccccct
ctctacggcccccccatgctgatgatgcccccaccgcccgcggccatggggcccccggga
gcccctcctggccgcgacctggcctccgtgccccctgaactgaccgccagcagacagtcc
ttccgcatggccatgggaaaccccagtgagttctttgtggatgtgatgtga

KEGG   Camelus dromedarius (Arabian camel): 105103047
Entry
105103047         CDS       T04642                                 

Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-2 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04330  Notch signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105103047
   04330 Notch signaling pathway
    105103047
   04390 Hippo signaling pathway
    105103047
   04150 mTOR signaling pathway
    105103047
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105103047
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105103047
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105103047
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105103047
   05226 Gastric cancer
    105103047
   05217 Basal cell carcinoma
    105103047
   05224 Breast cancer
    105103047
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105103047
   05022 Pathways of neurodegeneration - multiple diseases
    105103047
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105103047
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105103047
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 105103047
NCBI-ProteinID: XP_031323628
LinkDB
Position
16
AA seq 736 aa
MAGSGAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPAHEPRTDLAPPPPPLPPL
PPERTSGIGDSRPPSFHPNVSSSRENLEPETETESVVSLRRERPRRRDSSEHGAGGHRPS
GPSRLERHLAGYESSSTLMTSELESTSLGDSDEDDTMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSIH
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG
AGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEPGGTGDGGPPPSRGSSGGAPNLRA
HPGLHPYGPPPGMALPYNPMMVVMMPPPPPPIPPAVQPPGAPPVRDLGSVPPELTASRQS
FHMAMGNPSEFFVDVM
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggcgggcagcggcgcggggggcggtggtgtcggggagacgaaggtgatttaccacctg
gatgaagaagagactccctacctggtgaagatcccggtccccgctgagcgcatcaccctc
ggcgatttcaaaagcgtcttgcagcggcccgcgggcgctaagtactttttcaagtctatg
gatcaggatttcggggtggtgaaggaagaaatctcggatgacaacgcccgccttccctgc
ttcaatggaagggtggtgtcctggctagtgtcatcagataacccccagcctgagatggcc
cccccggcccatgagcctcggacagacctggcgcctccacccccaccactaccccctttg
ccaccggagaggaccagtggcattggggactccaggccgccatccttccaccctaacgtg
tccagcagccgcgagaatctggagcccgagacagaaaccgagtcagtagtgtctctgagg
cgggagcggcctcgcaggcgagacagcagtgagcacggcgccgggggccaccggcccagc
ggcccctcgaggctggagcgccacctggctgggtatgagagctcctccaccctcatgacc
agtgagctagagagcaccagcctgggggactcggacgaggacgacaccatgagcaggttc
agcagctccacggagcagagcagcgcctcccgcctcctcaagcgccatcggcggcggagg
aaacagcggccaccccgcctggagaggacttcatccttcagcagtgtcactgactccacc
atgtctctcaacatcatcacggtcacactgaacatggagaagtacaacttcctgggcatc
tccatcgtgggccaaagcaatgagcggggagacggtggcatctacataggctccatcatg
aagggtggggctgtggcagccgatggtcgcatcgagccgggggacatgcttctgcaggtg
aacgacatgaactttgagaacatgagcaacgacgacgcggtgcgggtgctgagggacatc
gtgcacaagccaggccccatcgtgctgactgtggccaagtgctgggatccctctccgcag
gcctatttcactctcccgcgaaatgaacccatccagccaattgaccctgctgcctgggtc
tcacactctgctgcactgaccggcaccttcccagcctatccaggctcctcgtccatgagc
accattacatctgggtcctctttgcctgatggctgtgagggccggggtctctccatccat
acagacatggcatctgtgaccaaggccatggcagccccagagtctggactggaagttcga
gaccgcatgtggctcaagatcaccatccctaatgcatttctgggctcagacgtggtcgac
tggctctaccatcacgtggagggctttcctgagcggcgggaggcccgcaagtatgccagt
gggctgctcaaggcggggctcatccggcacacggtgaacaagatcaccttctctgagcag
tgctattatgtcttcggagacctcagtggcggctgtgagagttatctagtcaacctgtct
ctgaatgacaatgatggctctagtggtgcttcagatcaggacaccttggctcctctgcct
ggggccaccccctggcccctgctgcccaccttctcctaccagtacccagctccgcaccca
tacagtcctcagcccccgccgtaccacgagctctcgtcctacacctacggaggaggcagt
gccagcagccagcacagtgaggggagccggagcagtgggtcgacacgaagcgatgggggg
gcagggcgcacagggaggcctgaggagcgggcccctgagtccaagtctggcagcggcagt
gagtcggagccctccagccggggaggcagccttcggcggggtggggaacctggtgggact
ggtgatgggggtcctcccccatccagaggctcatcaggaggtgctcccaatctccgagcc
cacccagggctccatccctatggaccccctcctggtatggccctcccctataaccccatg
atggtggtcatgatgcccccacccccaccccctattccgccagcagtgcagcctccaggg
gcccctccagtcagggacctgggctctgtgcccccagagttgacagccagccgccaaagc
ttccacatggccatgggcaaccctagtgagttctttgtggatgttatgtag

KEGG   Camelus dromedarius (Arabian camel): 105105575
Entry
105105575         CDS       T04642                                 

Gene name
DVL1
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-1 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04150  mTOR signaling pathway
cdk04310  Wnt signaling pathway
cdk04330  Notch signaling pathway
cdk04390  Hippo signaling pathway
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04916  Melanogenesis
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105105575 (DVL1)
   04330 Notch signaling pathway
    105105575 (DVL1)
   04390 Hippo signaling pathway
    105105575 (DVL1)
   04150 mTOR signaling pathway
    105105575 (DVL1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    105105575 (DVL1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105105575 (DVL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105105575 (DVL1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105105575 (DVL1)
   05226 Gastric cancer
    105105575 (DVL1)
   05217 Basal cell carcinoma
    105105575 (DVL1)
   05224 Breast cancer
    105105575 (DVL1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105105575 (DVL1)
   05022 Pathways of neurodegeneration - multiple diseases
    105105575 (DVL1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105105575 (DVL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105105575 (DVL1)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 105105575
NCBI-ProteinID: XP_031319646
LinkDB
Position
13
AA seq 713 aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEISDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDGHADLPPPLERTGGIGDSRPPSF
HPNVASSRDGMDNETGTESVVSHRRERARRRNREEASRTNGHQRGDRRRDLGLPPDSTST
VLSSELESSSFIDSDEDENTSRLSSSTEQSTSSRLIRKHKRRRRKQRMRQADRASSFSSI
TDSTMSLNIVTVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAITRTSSSSLTSSVPGAPQLEEAPLTVKSDMGAVVR
VMQLPDSGLEIRDRMWLKITIANAVIGEGPLAGGGAGRGSPATLVDWVALAVTTHLEGFK
ERREARKYASSMLKRGFLRHTVNKITFSEQCYYVFGDLCSNLAALNLNSGSSGASDQDTL
APLPHPAAPWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSAGSQQSEGSKSSGSTRSA
GGSSRRALGRSAGAGGSGSESDPTAPSGAGGSGWRERPASQLSRGSSPRSQASAAAPGLP
PLHPLTKAYSVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2142 nt   +upstreamnt  +downstreamnt
atggcggagaccaagattatctatcacatggacgaggaggagacgccgtacctggtcaag
ctgcccgtggcgcccgagcgcgtcacgctggccgactttaagaacgtgctcagcaaccgg
cccgtgcacgcctacaaattcttcttcaagtccatggaccaggacttcggggttgtgaag
gaggagatctccgacgataatgccaagctgccctgcttcaatggccgcgtagtctcctgg
ctggtcctggctgagggcgcgcactccgacgcggggtctcagggcactgacggccacgca
gacctgcccccgcctctcgagcgaacaggcggcattggggactcccggcccccctccttc
cacccgaatgtggccagcagccgtgatgggatggacaatgagactggcacggagtccgtg
gtcagccaccggcgggagcgagcccgacgccggaaccgtgaggaggcctcccggaccaac
gggcaccagaggggggaccggcgccgggacctggggctgccccccgacagcacatccacg
gtgctgagcagcgaactggagtccagcagcttcatcgactccgacgaggatgagaacacc
agccggctgagcagctccacggagcagagcacctcctcccgcctcatccggaagcacaaa
cgccggcggcggaagcagcgcatgcggcaggcagaccgggcctcctccttcagcagcatc
acggactccaccatgtccctgaacattgtcaccgtcacgctcaacatggagcggcaccac
tttctgggcatcagcatcgtgggccagagcaacgaccggggtgacggtggcatctacatc
ggctccatcatgaagggtggggctgtggccgctgacggacgcatcgagcccggcgacatg
ctgctgcaggtgaacgatgtcaacttcgagaacatgagtaacgacgatgcggtgcgggtg
ctgcgggagatcgtgtcccagactgggcccatcagcctcacggtggccaagtgctgggac
ccgaccccacggagctacttcaccatcccgagggctgaccccgttcggcccatcgacccg
gctgcctggctgtcccacacggcggcgctgaccggagccctgccccgctatggtacgagc
ccttgctccagcgccatcacccgcaccagctcctcctcactaaccagctctgtgcctggc
gctccgcagctggaggaggccccactgacggtgaagagtgacatgggcgccgtcgtccgc
gtcatgcagctgccggactcaggcttggagatccgagaccgcatgtggctcaagatcacc
attgccaacgctgtcatcggtgagggtcccctggctggtggcggggcagggcggggtagc
cccgcaacactggtcgattgggtggcccttgctgttaccacacacctggagggcttcaag
gagcggcgggaggcgcgcaagtacgccagcagcatgctgaagcggggcttcctgcggcac
acggtgaacaagatcactttctccgagcagtgctactacgttttcggggacctgtgcagc
aatcttgcggccctgaacctcaacagtggctccagtggggcctcggatcaggacacactg
gcacccctgccccacccggctgccccctggcccctgggtcagggctacccctaccagtac
ccagggcccccgccctgcttcccgcccgcataccaggaccctggtttcagctacggcagc
ggcagcgctgggagtcagcagagtgaaggaagcaaaagcagtgggtccacccggagtgct
ggcgggagcagccgtcgggccctgggccggtcggctggagccgggggcagcggcagtgag
tcagaccccacagcgccaagtggggcaggcggcagtggctggcgggagcgtccggctagc
cagctcagccggggcagcagcccacgcagtcaggcctcggctgccgccccagggctcccc
ccactgcaccccctgacaaaggcgtactctgtggtgggtgggccacctggggggccgcct
gtccgggagctggccgctgtccccccagagttgactggcagtcgccagtcattccagaag
gccatggggaacccctgtgagttctttgtcgatatcatgtga

DBGET integrated database retrieval system