KEGG   Camelus dromedarius (Arabian camel): 105086385
Entry
105086385         CDS       T04642                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2 isoform X1
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04068  FoxO signaling pathway
cdk04110  Cell cycle
cdk04114  Oocyte meiosis
cdk04115  p53 signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04218  Cellular senescence
cdk04914  Progesterone-mediated oocyte maturation
cdk04934  Cushing syndrome
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05162  Measles
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05215  Prostate cancer
cdk05222  Small cell lung cancer
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105086385 (CDK2)
   04151 PI3K-Akt signaling pathway
    105086385 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105086385 (CDK2)
   04114 Oocyte meiosis
    105086385 (CDK2)
   04115 p53 signaling pathway
    105086385 (CDK2)
   04218 Cellular senescence
    105086385 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    105086385 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105086385 (CDK2)
   05203 Viral carcinogenesis
    105086385 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    105086385 (CDK2)
   05215 Prostate cancer
    105086385 (CDK2)
   05222 Small cell lung cancer
    105086385 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105086385 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105086385 (CDK2)
   05161 Hepatitis B
    105086385 (CDK2)
   05160 Hepatitis C
    105086385 (CDK2)
   05162 Measles
    105086385 (CDK2)
   05169 Epstein-Barr virus infection
    105086385 (CDK2)
   05165 Human papillomavirus infection
    105086385 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105086385 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cdk03032]
    105086385 (CDK2)
   03036 Chromosome and associated proteins [BR:cdk03036]
    105086385 (CDK2)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     105086385 (CDK2)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: CMGC group
  CDK family
   105086385 (CDK2)
DNA replication proteins [BR:cdk03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    105086385 (CDK2)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105086385 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 105086385
NCBI-ProteinID: XP_010975194
LinkDB
Position
12
AA seq 353 aa
MENFQKVEKIGEGTYGVVYKAKNKVTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSFLSPLQSYLFQLLQ
GLAFCHSHRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEI
LLGCKYYSTAVDIWSLGCIFAEMHLVCTQHHARCYGEHRRNGRHSLCPLCSYLEVAASQG
GGMTEVSTPHPVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWAR
QDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggagaacttccaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gccaaaaacaaggtgacgggagaagtggtggcgcttaaaaaaatccgcctggacactgag
acggagggtgtacccagtactgccatacgagagatctctctgcttaaggagcttaaccac
cctaatattgtcaagctgctggatgtcattcacacagaaaacaaactctacctggttttt
gagtttctgcaccaggatctcaagaaattcatggatgcctctgctctcactggcattcct
cttccccttatcaagtcttttctctcccctcttcagagctatctgttccagctgctccag
ggcctagctttctgccattctcatcgcgtcctgcaccgagacctcaaacctcaaaatctg
cttatcaacgcagaggggtccataaaactagctgactttggactagccagagcctttgga
gtccctgttcgtacttacactcatgaggtggtgactctgtggtaccgagcacctgaaatc
cttctgggctgcaaatactactccacagcagtggacatctggagcctgggctgcatcttt
gctgagatgcacctagtgtgtacccagcaccatgctaggtgctatggggaacacagaaga
aatggaagacacagtctctgcccgctgtgctcctatctagaagtggctgcatcacaagga
ggggggatgaccgaagtgtctaccccacaccccgtgactcgccgggccctattccccgga
gattctgagatcgatcaactcttccggatctttcggactctggggacccctgatgaggtg
gtttggccaggagttacttctatgcctgattataagccgagtttcccaaagtgggccagg
caagattttagcaaagttgtgcctccgctggatgaagatggacggagcttgttatcgcaa
atgctgcactacgaccccaacaagcggatttcagcaaaggcagctctggctcaccctttc
ttccaggatgtgaccaagccagtaccccaccttcgactctga

DBGET integrated database retrieval system