KEGG   Camelus dromedarius (Arabian camel): 105086410
Entry
105086410         CDS       T04642                                 

Gene name
SHC3
Definition
(RefSeq) LOW QUALITY PROTEIN: SHC-transforming protein 3
  KO
K17448  SHC-transforming protein 3
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04062  Chemokine signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04510  Focal adhesion
cdk04650  Natural killer cell mediated cytotoxicity
cdk04722  Neurotrophin signaling pathway
cdk04910  Insulin signaling pathway
cdk04915  Estrogen signaling pathway
cdk04917  Prolactin signaling pathway
cdk04926  Relaxin signaling pathway
cdk04935  Growth hormone synthesis, secretion and action
cdk05034  Alcoholism
cdk05100  Bacterial invasion of epithelial cells
cdk05214  Glioma
cdk05220  Chronic myeloid leukemia
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105086410 (SHC3)
   04014 Ras signaling pathway
    105086410 (SHC3)
   04072 Phospholipase D signaling pathway
    105086410 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105086410 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    105086410 (SHC3)
   04062 Chemokine signaling pathway
    105086410 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105086410 (SHC3)
   04915 Estrogen signaling pathway
    105086410 (SHC3)
   04917 Prolactin signaling pathway
    105086410 (SHC3)
   04926 Relaxin signaling pathway
    105086410 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    105086410 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    105086410 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105086410 (SHC3)
   05226 Gastric cancer
    105086410 (SHC3)
   05214 Glioma
    105086410 (SHC3)
   05220 Chronic myeloid leukemia
    105086410 (SHC3)
   05224 Breast cancer
    105086410 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    105086410 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    105086410 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105086410 (SHC3)
   01522 Endocrine resistance
    105086410 (SHC3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 105086410
NCBI-ProteinID: XP_031297920
LinkDB
Position
31
AA seq 656 aa
MGASPCTLFLEALQGSRWEAGAAAPRHPPPPPPPHPPRGCPATPSRPGTAARLHARQPAP
GAGTCSARADAASPRRGRLPRTKYNRFRNDSVTSVDDLLHNLSVSGGGXVSRARGPAAAP
YLVSGDALRRAPDDGPGAWATAPQGVHLKLXSSGLRGLSAARRRGGRLRAAGTTSWRRLR
AASGPAMAXARQGRPGDEPPPCAPHASDQVLGAGVTYVVKYLGCIEVLRSMRSLDFSTRT
QITREAISRVCEAVPGAKGAFRRRKPPSKMLSSILGKRNLQFAGTSISLTISTASLSLRT
PDSKQIIANHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIG
QAFELRFKQYLQCPSKIPALHDRMQSLDEPWTEEEGDGSDHPYYNSIPSKTPPPGGFVDA
RLKARPHGPDVAQFAGKEQTYYQGRHLGDPFGEDWQQAPARQGALDIYSVPAGRSPVATA
GEAPAYVNTQRAPRQARPAAGSSAESSPRRDLFDMKPFEDALKNQPLGPVLSKAASVECI
SPVSPRAPDARMLEELRAEPWYQGEMSRKEAERLLKTDGDFLVRKSATNPGSFVLTGMHN
GQAKHLLLVDPEGTIRTKDRIFDSISHLITHHLENSLPIVSAGSELCLQQPVGRNP
NT seq 1971 nt   +upstreamnt  +downstreamnt
atgggtgcctccccttgcaccctgttccttgaagcccttcaaggctcgcggtgggaggcc
ggcgccgccgccccgcgccaccccccaccccccccccccccccaccccccccgcggctgt
ccggccactccgtcccgcccggggaccgcggctcgcctgcatgcgcggcagcccgcgccg
ggggctggcacctgcagcgcccgggcggatgcggcgagcccacggaggggcaggcttcca
cgcaccaagtacaaccgcttcaggaatgactcggtgacatcggtcgatgaccttctgcac
aacctgtcggtgagcggcggcggcnaggtctcgcgggcgcgcgggccggcggcggccccc
tacctggtgtccggagacgcgctgcgcagggcgcccgacgatgggccgggagcctgggcc
actgctccacaaggtgtccacctgaaactcntcagctcgggcctccgcggcctgtcggcg
gccaggaggcggggggggcggcttagggcagctgggacgaccagctggcgcaggctgcgg
gcggcaagcggcccggcaatggccngcgcccgccagggccgccccggcgacgagccgccg
ccctgcgccccgcacgccagcgaccaggtgctgggggccggagtcacctacgtcgtcaag
tacttggggtgcatcgaagttctgcgctccatgaggtcgctggacttcagcaccaggacg
cagattaccagagaagccatcagccgggtctgcgaagccgtgcccggggccaagggagcc
ttcaggaggagaaagcctccgagcaaaatgctgtccagcatcctgggcaagaggaacctc
cagttcgcggggacgagcatctccctgaccatatccaccgccagcctgagcctgcggacg
ccggactcgaagcagatcatagccaatcatcacatgcagtccatctccttcgcctccggg
ggggacccggacacaacagactacgttgcgtacgtcgctaaggaccccgttaaccgcaga
gcctgtcacattctggagtgctgtgacgggctggcccaggatgtcatcggctccatcgga
caggcctttgagctccggttcaagcagtatttgcagtgtccttccaagatccctgctctc
cacgaccgaatgcagagtctagatgagccatggactgaagaggagggtgacggctcagac
cacccgtactacaacagcattccaagcaagacgcctcctccaggggggtttgtggatgct
agactgaaagccagaccccacggccctgacgtggcccagtttgcagggaaagaacagact
tactaccaggggagacacttaggagacccgtttggagaagactggcagcaagcacctgcc
aggcaaggggccttggacatctacagcgtgccagccgggagatcgcccgtggccaccgcc
ggagaggcccccgcctatgtcaacacgcagcgcgccccgcggcaggcccggccggccgcc
ggcagcagcgcagagagcagccccaggagagacctctttgatatgaagcctttcgaagac
gctctcaagaaccagccgttggggcctgtgctgagtaaggcggcctccgtggagtgcatc
agccccgtctcacccagggccccggacgccaggatgctggaagagctgagagcggagcct
tggtaccagggggagatgagcaggaaggaggcagagcggctgctgaagacggatggagac
ttcctggtcaggaagagcgccaccaaccccggctccttcgtcctcactggcatgcacaac
ggccaggccaagcacctgctgctcgtggacccagaaggcacgatccggacaaaggacagg
atctttgacagcatcagccacctcatcacccaccacctggagaacagcctgcccatcgtc
tccgccgggagcgagctctgcctccagcagccggtgggaaggaacccgtga

KEGG   Camelus dromedarius (Arabian camel): 105089005
Entry
105089005         CDS       T04642                                 

Gene name
SHC1
Definition
(RefSeq) SHC-transforming protein 1 isoform X1
  KO
K06279  SHC-transforming protein 1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04062  Chemokine signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04510  Focal adhesion
cdk04650  Natural killer cell mediated cytotoxicity
cdk04722  Neurotrophin signaling pathway
cdk04910  Insulin signaling pathway
cdk04915  Estrogen signaling pathway
cdk04917  Prolactin signaling pathway
cdk04926  Relaxin signaling pathway
cdk04935  Growth hormone synthesis, secretion and action
cdk05034  Alcoholism
cdk05100  Bacterial invasion of epithelial cells
cdk05206  MicroRNAs in cancer
cdk05214  Glioma
cdk05220  Chronic myeloid leukemia
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105089005 (SHC1)
   04014 Ras signaling pathway
    105089005 (SHC1)
   04072 Phospholipase D signaling pathway
    105089005 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105089005 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    105089005 (SHC1)
   04062 Chemokine signaling pathway
    105089005 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105089005 (SHC1)
   04915 Estrogen signaling pathway
    105089005 (SHC1)
   04917 Prolactin signaling pathway
    105089005 (SHC1)
   04926 Relaxin signaling pathway
    105089005 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    105089005 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    105089005 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    105089005 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105089005 (SHC1)
   05226 Gastric cancer
    105089005 (SHC1)
   05214 Glioma
    105089005 (SHC1)
   05220 Chronic myeloid leukemia
    105089005 (SHC1)
   05224 Breast cancer
    105089005 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    105089005 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    105089005 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105089005 (SHC1)
   01522 Endocrine resistance
    105089005 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 105089005
NCBI-ProteinID: XP_010978305
LinkDB
Position
21
AA seq 584 aa
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPMLPPLPGDDSPTTLCS
FFPRMSNLKLANPAGGRPGPKGEPGRAAEDGEGIVGAAILDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAPPGAARPPPPSAQTPSHLGATLPVGQPVGGDPEVRKQMLPPPPCPAGR
ELFDDPSYVNVQNLDKARQAGGGAGPPHPAINGSAPRDLFDMKPFEDALRVPPPPQSVAM
AEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPE
GVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKV
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggatctcctgccccccaagcccaagtacaacccacttcggaatgagtctctgtcatcg
ctggaggagggggcttcagggtctaccccaccggaggagctgccttccccgtctgcctca
tccctggggcccatgctgccacctctgcctggggacgacagtcccactactctgtgctcc
ttcttcccccggatgagcaacctcaagctggccaacccggctggggggcgtccagggccg
aagggggagccaggaagggcagccgaggatggggaggggatcgttggggcagccatcctg
gactcaggccccctgcccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggggccagctggggggcgaggagtggacccgccacgggagcttt
gtcaataagcccacacggggctggctgcatcccaacgacaaagtcatgggaccgggggtt
tcctacttggttcggtacatgggctgtgtggaggtcctgcagtcaatgcgtgcccttgac
ttcaatacccggactcaggtcaccagggaggccatcagtctggtgtgtgaggctgtgccg
ggtgctaagggggcgacaaggaggagaaagccctgtagccgcccactcagctccatcctt
ggaaggagtaacctgaaatttgctggaatgccaatcactctcaccgtctccaccagcagc
ctcaacctcatggccgcagactgcaaacagatcatcgccaaccaccacatgcaatccatc
tcgtttgcatccggcggggacccggacacagctgagtatgttgcctatgttgccaaagac
ccggtgaatcagagagcctgccacatcctggaatgtccagaagggctcgctcaggacgtt
atcagcaccattggccaggcctttgagttgcgcttcaaacaatacctcaggaacccgccc
aagctggtcaccccccatgacaggatggctggctttgatggctcagcgtgggatgaggag
gaggaagagccacctgaccatcagtactataatgacttcccggggaaggaaccccctctt
gggggggtggtggacatgaggcttcgagaaggagccccaccgggggctgctcgaccccct
ccacccagtgcccagactcccagccacctgggagctactctgcctgtggggcagcctgtc
gggggagaccctgaagtccgcaaacagatgctgcctccaccaccctgtccagcaggcaga
gaactctttgatgatccctcctacgtcaacgtccagaacctagacaaggctcggcaagca
gggggcggggccgggcccccccatcctgccatcaatggcagtgctcctcgagacctcttt
gacatgaagccctttgaagatgcccttcgggtgcctccacctccccagtcggtggccatg
gctgagcagctccgaggggagccctggttccacgggaagctgagccgacgggaggccgag
gcactgctgcagctcaacggggacttcctggtgcgggaaagcacgaccacacctggccag
tacgtgctcactggcttgcagagtgggcagcccaagcacctgctgctggtggaccctgag
ggtgtggttcggacaaaggatcaccgctttgagagtgtcagtcacctcatcagctaccac
atggacaatcacttgcccatcatctctgcgggcagcgaactgtgtctacagcagcctgtg
gagcggaaagtctga

KEGG   Camelus dromedarius (Arabian camel): 105093416
Entry
105093416         CDS       T04642                                 

Gene name
SHC2
Definition
(RefSeq) LOW QUALITY PROTEIN: SHC-transforming protein 2
  KO
K17447  SHC-transforming protein 2
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04062  Chemokine signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04370  VEGF signaling pathway
cdk04510  Focal adhesion
cdk04650  Natural killer cell mediated cytotoxicity
cdk04722  Neurotrophin signaling pathway
cdk04910  Insulin signaling pathway
cdk04915  Estrogen signaling pathway
cdk04917  Prolactin signaling pathway
cdk04926  Relaxin signaling pathway
cdk04935  Growth hormone synthesis, secretion and action
cdk05034  Alcoholism
cdk05100  Bacterial invasion of epithelial cells
cdk05214  Glioma
cdk05220  Chronic myeloid leukemia
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105093416 (SHC2)
   04014 Ras signaling pathway
    105093416 (SHC2)
   04370 VEGF signaling pathway
    105093416 (SHC2)
   04072 Phospholipase D signaling pathway
    105093416 (SHC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105093416 (SHC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    105093416 (SHC2)
   04062 Chemokine signaling pathway
    105093416 (SHC2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105093416 (SHC2)
   04915 Estrogen signaling pathway
    105093416 (SHC2)
   04917 Prolactin signaling pathway
    105093416 (SHC2)
   04926 Relaxin signaling pathway
    105093416 (SHC2)
   04935 Growth hormone synthesis, secretion and action
    105093416 (SHC2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    105093416 (SHC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105093416 (SHC2)
   05226 Gastric cancer
    105093416 (SHC2)
   05214 Glioma
    105093416 (SHC2)
   05220 Chronic myeloid leukemia
    105093416 (SHC2)
   05224 Breast cancer
    105093416 (SHC2)
  09165 Substance dependence
   05034 Alcoholism
    105093416 (SHC2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    105093416 (SHC2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105093416 (SHC2)
   01522 Endocrine resistance
    105093416 (SHC2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 105093416
NCBI-ProteinID: XP_031292689
LinkDB
Position
22
AA seq 671 aa
MPPVGLSFPQPPYRAPGRLRTGVPGVQPPAAARWAGRMTSPGRGRGGSGRASSAPGAAPG
PARSGGRGHDAGPGGRAPPRAPPTPDPHAPPPSRSAAAHPHVSSPPSASWAAPTRRGTGG
RAGAPTSSPSPTRARARARAGWSAASLRWRPRSWAPASRAAWRPVPCLPLAAAGPVGAGG
AGAAGARGSAGPPDAAADEWIRKGSFIHKPAHGWLHPDARVLGPGVSYIVRYMGCIEVLR
SMRSLDFSTRTQVTREAITRLHEAVPGVRGSWKKKAPNKALASILGKSNLRFAGMSIAVS
ISIDGLNLSVPATRQIIANHHMQSISFASGGDTDMADYVAYVAKDPINQRACHXLECCEG
LAQSVISTVGQAFELRFKQYLHSPPKVVLPLERLTGLEDSAWGDEEELEHNYYNSIPGKE
PPLGGLVDSRLALTQPCPLGTPGALGQAASPARRDTRGLQWDMGPSAPAAPGDGYVQADA
RGPRDYEDHLYVNTQGLDGPEPLQPEDSPQRDLFDMRARSVLPSSEGPFEDALRLHECSV
AAGTAAAPLPVEDQWAQPPDPRPIAPTEEQLRQEPWYHGQMSRRAAEKLLRADGDFLVRD
SVTNPGQYVLTGMHAGQPKHLLLVDPEGVVRTKDALFESISHLVDYHLQHGQPIVAAGSE
LHLRGAVKREP
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgcccccggtgggcctcagtttcccccagcctccctaccgggcgccgggacgcctaagg
acgggggtcccaggggtgcagccccccgcggctgcgcgctgggctggacggatgacatca
ccgggccgggggcggggagggagcgggagggcctcctccgcgccaggcgcagcgcccggt
ccggctcggtcgggcggccgcggccatgacgcaggtccgggcgggcgcgcgcccccccgc
gccccccccacccccgacccgcacgcaccaccaccttcgcgctctgctgccgcgcatcct
catgtaagttctcccccctccgcttcctgggccgcgcccacgcggcgcgggaccgggggc
cgggccggggcaccgacctcgagcccgagcccgacccgagcccgagcccgagcccgagcc
ggctggtccgcggcgtccctgcgctggcggccgcggtcctgggcgcctgcgagccgcgct
gcatggcgccctgtcccctgcctgcccctagccgctgccgggcccgtgggcgcggggggc
gcgggggccgcgggggcgcgggggtcggccgggcccccggacgccgccgccgacgagtgg
atccgcaaaggcagcttcatccacaagccggcgcacggctggctacacccagacgccagg
gtcctgggtcctggggtctcctacatcgtgcggtacatgggctgcatcgaagtcctccgc
tccatgcgctccctggacttcagcactcgcacccaggtcaccagggaagccatcacccga
ctccatgaggctgtgcctggtgtcaggggttcctggaagaagaaggcccccaacaaggcg
ctggcctccatcctgggtaagagcaacctgcgcttcgcaggaatgagcattgcagtcagc
atctccatcgatggcctcaacctctcggtgccggccacgcgccagatcatcgccaaccac
cacatgcagtccatctccttcgcatcgggtggcgacacggacatggcggattacgtggcc
tatgtggccaaggaccccatcaaccagagagcctgccacnnattggagtgctgcgagggc
ctggcccagagtgtcatcagcaccgtggggcaagccttcgagctacgcttcaaacagtac
ctgcacagcccccccaaggtggttttgcccctggaaaggctgaccgggctggaggattcg
gcctggggggatgaggaggagctggaacacaactactacaacagcatcccggggaaggag
ccgcccctgggcggtctggtggactccaggctcgccctcacacagccctgcccgctcggg
acccctggagccctcggccaggcagcatctcctgctcgaagagacacccgcggcctgcag
tgggacatgggcccctcagcgccagccgcgcctggggacggctacgtgcaggcggacgcc
cggggcccccgagactacgaggaccacctgtacgtcaacacgcagggtctggacggcccc
gagccgctgcagcccgaggacagcccccagagggacctgttcgacatgcgtgctcggtca
gtgctgcccagttcagagggaccctttgaggacgccctgaggctgcatgagtgctccgtt
gcggcgggcactgcggcagcccccctcccggtggaggaccagtgggcccagccccccgac
ccgcgccccatcgcccccaccgaggagcagctgcggcaggagccctggtaccacggccag
atgagccgtcgggcggccgagaaactgcttcgagccgacggggacttcctcgtgcgcgac
agtgtcaccaaccccggacagtacgtcctcactggcatgcacgcggggcagcccaagcac
ctgctgctggtggaccctgagggcgtggtgcggaccaaggacgcactgttcgaaagcatc
agccacctggtcgactaccacctgcagcacgggcagcccatcgtggccgcggggagcgag
ctgcacctgcgcggcgcggtcaagcgggagccctga

KEGG   Camelus dromedarius (Arabian camel): 105104832
Entry
105104832         CDS       T04642                                 

Gene name
SHC4
Definition
(RefSeq) SHC-transforming protein 4
  KO
K17449  SHC-transforming protein 4
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04062  Chemokine signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04510  Focal adhesion
cdk04650  Natural killer cell mediated cytotoxicity
cdk04722  Neurotrophin signaling pathway
cdk04910  Insulin signaling pathway
cdk04915  Estrogen signaling pathway
cdk04917  Prolactin signaling pathway
cdk04926  Relaxin signaling pathway
cdk04935  Growth hormone synthesis, secretion and action
cdk05034  Alcoholism
cdk05100  Bacterial invasion of epithelial cells
cdk05206  MicroRNAs in cancer
cdk05214  Glioma
cdk05220  Chronic myeloid leukemia
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105104832 (SHC4)
   04014 Ras signaling pathway
    105104832 (SHC4)
   04072 Phospholipase D signaling pathway
    105104832 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105104832 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    105104832 (SHC4)
   04062 Chemokine signaling pathway
    105104832 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105104832 (SHC4)
   04915 Estrogen signaling pathway
    105104832 (SHC4)
   04917 Prolactin signaling pathway
    105104832 (SHC4)
   04926 Relaxin signaling pathway
    105104832 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    105104832 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    105104832 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    105104832 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    105104832 (SHC4)
   05226 Gastric cancer
    105104832 (SHC4)
   05214 Glioma
    105104832 (SHC4)
   05220 Chronic myeloid leukemia
    105104832 (SHC4)
   05224 Breast cancer
    105104832 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    105104832 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    105104832 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105104832 (SHC4)
   01522 Endocrine resistance
    105104832 (SHC4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 105104832
NCBI-ProteinID: XP_010996899
LinkDB
Position
6
AA seq 630 aa
MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSPGASAGNKGSPQPPY
PALAPHLPAEDATSASQESPTPLCTLIPRMASVKLANPSTLLSLKNFCLGTKEVPRLKLQ
ESQDPAPSSPASPETSLNRTGPAPLPQQDSVGHRATSLTPDAHPLPGPGEPTPGSRQDRH
LLQHLLGMGMNYYVRYMGCIEVLQSMRSLDFGKRTQVTREAISRLCEAVPGANGAIKKRK
PPAKFLSTVLGKSNLQFSGMNVKLTISTCSLTLMNLDNRQIIANHHMQSISFASGGDPDT
TDFVAYVAKDPVNQRACHILECRSGTAQDVISTIGQAFELRFKQYLKNPSLNASCESEEV
HVDGHAEERGDHEYYNEIPGKQPPAGGVSDVRIQVQATEQMAYCPIRCEKLCYLPGNSKC
SSVYENCLEQSRAAGSAHERGVQSQREASLRKHTCRVDLFDDPSYINTQALQSTLVSAGN
QSSAHPLGSPWHREKAPETVQPGATAQPASTHSLPLIKQQLRSEDCYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRKDNNPGLLHSNK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgcgagaacgcggtcaggacagcctggcaggactcgtgctgtatgtaggactctttggg
caccccgggatgctgcacagggccaagtacagccgctttcggaacgagtccatcacatcc
cttgacgaaggcagccccggagcctccgccgggaacaagggctcgccgcagcctccctac
ccggccctggcacctcacctgccggctgaagatgccacctcggcgtcccaggagagcccc
accccactgtgcaccttgatccctcgcatggccagtgtaaagctggccaacccatccacc
ttgctgagtctgaaaaacttttgcttgggtaccaaagaggtacctcggctgaagctccaa
gaaagccaggacccggcccccagcagcccagcttcccctgaaaccagtctgaacaggact
ggaccagcacctctgcctcagcaggactcggtggggcacagggcgacctctttaactcct
gatgcccacccccttcctggtcctggggagccaacccctgggagcaggcaggacaggcac
cttctgcagcacctgctggggatgggcatgaactactatgtgaggtacatgggctgtatt
gaagtgctgcaatcaatgaggtcactggattttggaaagagaacccaagttacaagggaa
gcaataagtcgcctgtgtgaagctgtccctggggccaatggagccattaaaaagcgcaag
cctccagccaagtttctatcaacagttcttggcaaaagtaatcttcagttctcgggaatg
aacgtaaagctgaccatctccacgtgcagcctcacactgatgaaccttgacaaccgacag
attattgcaaatcatcatatgcagtctatttcatttgcctctggaggagatcctgatacc
acagactttgttgcctacgtagctaaagatccagttaaccaacgagcctgccacatattg
gagtgccgcagtggaacggcccaagacgtcataagtaccatagggcaggccttcgaactc
cggttcaaacagtatttgaaaaatccttctttgaatgcgtcttgtgaaagtgaggaggtg
catgttgatggccatgccgaggagagaggagatcatgagtattacaatgaaatcccaggg
aagcagccacctgctggtggtgtttcagatgtgcggatccaagttcaagccacagaacaa
atggcttactgtcccatacggtgtgaaaagttgtgctatttgcctggaaactccaagtgc
agcagtgtatatgagaactgtttagaacaaagcagggccgcgggtagtgcacatgagaga
ggggtgcagtcccaacgagaggcgtcactgaggaagcacacgtgtcgagtggatctcttc
gacgacccctcctacattaatacgcaggctcttcaaagcacacttgtctctgccggaaat
caaagctcagctcacccactggggagcccgtggcaccgtgaaaaggcaccagaaactgtt
cagccaggtgccacggcccagcctgccagcacgcattctctgccactcattaaacagcaa
ctgcggagtgaagactgctaccacggcaagctgagcaggaaagcggcagagagcctcttg
gtaaaggacggggacttcctggttcgagagagtgcaacatctcctggccagtatgtgctg
agtgggctccagggaggccaggcaaaacatcttctcctggtggaccctgaaggcaaggtg
aggaccaaggatcatgtatttgataatgtgggccaccttatcagataccatatggataat
agtttgccaatcatctcttctggaagtgaagtaagccttaaacaaccagtgagaaaagat
aataatccaggacttttgcattccaacaaatga

DBGET integrated database retrieval system