KEGG   Camelus dromedarius (Arabian camel): 105086559
Entry
105086559         CDS       T04642                                 

Gene name
AIM2
Definition
(RefSeq) LOW QUALITY PROTEIN: interferon-inducible protein AIM2
  KO
K12966  absent in melanoma 2
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04621  NOD-like receptor signaling pathway
cdk04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    105086559 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    105086559 (AIM2)
SSDB
Motif
Pfam: HIN
Other DBs
NCBI-GeneID: 105086559
NCBI-ProteinID: XP_010975383
LinkDB
Position
21
AA seq 219 aa
MASVCCLQPEQKQMVTQQECIKEEGLPKSPMTVVMLKATKPFEFEAPEEKQEMFHATVAT
GSEFSFCKSFQKSXRKKKKKLKNKFTPKKIIIISKYYWHSXFLDVKSASLVCDAESDHQI
SVVPKHVIRKAGGTSKFSKLQTWPLGAVVNELFVVQKKTKQRNHIXFDLNDKTRRMKVLV
LGKENRIQVEEGDKLDLTFFELSKTGSKLQLKLGVHSFH
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcttctgtctgttgtcttcagcctgagcagaaacagatggtgactcagcaggaatgc
atcaaggaagaagggctgccaaaaagccctatgacagtcgtgatgctgaaagcaacgaag
ccatttgaatttgaggccccagaagagaagcaagagatgtttcatgctacagtggctact
gggagtgaattctctttttgtaaaagttttcaaaaaagctaaaggaaaaaaaaaaaaaag
ctaaaaaataaattcactccaaagaaaataattataatatcaaaatattattggcacagt
ntgttcctggatgtgaagagtgcctcccttgtgtgtgatgctgaatctgaccaccagatc
agtgttgtcccaaagcacgttatcagaaaagctggtggaacctcaaagttcagcaagctt
caaacctggcctcttggagcagttgtgaatgagctatttgtagtccagaagaaaacaaaa
cagaggaatcatatataatttgacctaaatgacaagacaaggaggatgaaagtactggtg
cttggaaaagagaacagaatccaggttgaggaaggggataaacttgacttaacattcttc
gaattgtcaaaaactggaagcaaactacagctgaaacttggagttcatagttttcattaa

DBGET integrated database retrieval system