KEGG   Camelus dromedarius (Arabian camel): 105086775Help
Entry
105086775         CDS       T04642                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04146  Peroxisome
cdk04213  Longevity regulating pathway - multiple species
cdk05014  Amyotrophic lateral sclerosis (ALS)
cdk05016  Huntington disease
cdk05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105086775 (SOD1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105086775 (SOD1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    105086775 (SOD1)
   05016 Huntington disease
    105086775 (SOD1)
   05020 Prion diseases
    105086775 (SOD1)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     105086775 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 105086775
NCBI-ProteinID: XP_010975659
UniProt: H6BDU4
LinkDB All DBs
Position
Un
AA seq 153 aa AA seqDB search
MALKAVCVLKGDGQVQGTIHFEQKENGPVMVSGSISGLAEGDHGFHVHQFGDNTQGCTSA
GPHFNPLSKKHGGPKDQERHVGDLGNVTAGKDGVAIVSIEDPVISLSGDHSIIGRTMVVH
EKPDDLGKGGNEESTKTGNAGSRLACGVIGIAQ
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgaaggctgtgtgcgtgctgaagggcgacggccaggttcagggcaccatccac
ttcgagcagaaggaaaatgggccagtcatggtatcggggtccatttcaggattggccgaa
ggcgatcatggattccatgtccatcagtttggagataacacacaaggctgtaccagtgca
ggtcctcactttaatcctctgtccaaaaaacatggtgggccaaaggatcaagagaggcat
gttggagacctgggcaatgtgactgctggcaaagatggtgtggccattgtgtctattgaa
gatcctgtgatctcactctcaggagaccattccatcattggccgcacaatggtggtccat
gaaaaaccagatgacttgggcaaaggtggaaatgaagaaagtacaaagacgggaaatgct
ggaagtcgtctggcctgcggcgtgattgggatcgcccaataa

DBGET integrated database retrieval system