KEGG   Camelus dromedarius (Arabian camel): 105086868
Entry
105086868         CDS       T04642                                 

Gene name
ZEB1
Definition
(RefSeq) LOW QUALITY PROTEIN: zinc finger E-box-binding homeobox 1
  KO
K09299  zinc finger homeobox protein 1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk05202  Transcriptional misregulation in cancer
cdk05206  MicroRNAs in cancer
cdk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    105086868 (ZEB1)
   05206 MicroRNAs in cancer
    105086868 (ZEB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    105086868 (ZEB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105086868 (ZEB1)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    105086868 (ZEB1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-Di19 zf-met zf-C2H2_jaz Homeodomain zf-C2H2_6 zf-C2HE zf-C2H2_2
Other DBs
NCBI-GeneID: 105086868
NCBI-ProteinID: XP_031300747
LinkDB
Position
35
AA seq 1104 aa
MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVADAADCEGGPAED
DLPADQAVVPGSSGREGSATSCWEGDAGKEGQETLGPEARADEVGHTVKDDECDSDAENE
QNHDPNVEEFLQQQDTAVIYPEAPEEDQRQGTPEASGHDDNGTPDAFSQLLTCPYCDRGY
KRFTSLKEHIKYRHEKNEDNFSCSVCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGGNRK
FKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLVPVN
GRPRPGLKTPQCSSPSLSASPGSPTRPQIRQKPDNKPLQEQLSVNQIKTEPVDYEFKPIV
VTSGISCSTPLQNGVFGGGGPLQAAGSPQGVVQAVVLPTVGLVSPISINLSDIQNVLKVA
VDGNVIRQVLENNQANLASKEQETINASSLQQGGHSVISAISLPLVDQDGTTKIIINYSL
EQPSQLQVVPQNLKKENPVPTNSCKNEKLPEDLTVKPEKDKSFEGGGSDSTCLLCDDCPG
DITALPELKRPAPPPPPAPEADQPEPPAASGPGDGHLSPSQPPLKNLLSLLKAYYALNAQ
PSADELSKIADSVNLPLDVVKKWFEKMQAGQISVQPSEPPSPEPGKGPVPAKNDDQPQPA
SASEPQASPGDLQSPLKTTGSPVLPVGSAAGGSRSRPPSPSPLNLSSPRSTQGYLYAAEG
AQEELQVEPLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQKDSCVTD
SEPVVNVVPPSANPINIAVPTVTAQFPTIVAIADQSSVPCLRALAANKQTILIPQVSYTY
STTVSPAVQEPPLKVVQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTENGMYA
CDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKPYQCDKC
GKRFSHSGSYSQHMNHRYSYCKREAEERDAEPGEPXGAGPGPGPGDSDDRESLTREEDED
SDKEEEEEEEKETEDLQEDKESGKAPGXEEEEEEMEEMEEEEEGEGAKTEGAMEGAGAAS
RAGTLEGKVSEGSEPASEEKTNEA
NT seq 3315 nt   +upstreamnt  +downstreamnt
atggcggatggccccaggtgtaagcgcagaaagcaggcgaacccgcggcgcaataacgtt
acaaattataacactgtggtagaaacaaattcagattcagacgatgaagacaaactccac
atcgtggaagaagaaagtgtcgccgatgcagcggactgtgaaggaggcccggcggaagac
gacctgccagcagaccaggccgtggtacccgggagcagtggccgagaagggagcgccacg
agctgctgggagggtgacgcaggaaaggaaggacaagaaaccctggggcctgaagctcgg
gcagatgaagtgggacacacagtaaaagatgacgaatgcgactcagatgcagagaatgaa
caaaaccacgaccctaatgttgaggagttcctgcagcaacaagacactgctgtcatctac
cccgaggcgccggaggaggaccagaggcaggggacgcctgaggccagcggccacgatgac
aacggaacaccagatgcgttttcccagttactcacctgcccatactgtgacagaggatat
aaacgcttcacctctctgaaagaacacattaagtaccgccatgagaagaatgaggacaac
ttcagctgctccgtgtgcagttacaccttcgcgtacagaacccaacttgaacgtcacatg
acgtcacataagtcaggacgagatcagagacatgtgacgcagtctgggggtaatcgtaaa
ttcaagtgcactgaatgtggaaaagctttcaaatacaaacaccatctaaaagaacactta
agaatccacagtggagagaagccatatgaatgcccaaactgcaagaaacgtttctcccat
tccgggtcctacagctcgcacatcagcagtaagaagtgcatcagcctggtgcccgtgaac
gggcggccgagacccgggctcaagaccccccagtgctcctcgccgtccctctcggcgtcc
ccgggcagccccacgcgcccgcagatccggcagaagccagacaataaaccccttcaagaa
cagctctccgtgaaccaaattaaaactgagcctgtggattatgagttcaaacccatcgtg
gtcacttcaggaatcagctgctcgacccccctacagaacggggtcttcggtggtggtggc
ccgttgcaggcggccggttctcctcagggtgtggtgcaggccgtcgtcctgcccacggtg
ggtttggtgtcgcccataagcatcaacttgagtgacatccagaatgtactcaaagtggca
gtagacggtaacgtaatcaggcaggtcttggagaataatcaagccaatctcgcatccaaa
gaacaagaaacaatcaatgcttcatccctacagcaagggggccactcggtcatttcggcc
atcagtcttcctctggttgatcaagacggaacaaccaaaattatcatcaactacagtctt
gaacagcccagccaactccaggtcgttcctcagaatttaaaaaaagaaaatccagtcccc
acaaacagctgcaaaaacgaaaagttaccggaagatcttacagttaaacccgagaaggac
aaaagcttcgaaggaggcgggagcgacagcacttgcctgctgtgtgatgactgccccggg
gacatcaccgccctgcccgagctgaagcggccggccccgccccccccgcccgcccccgag
gccgaccagcccgagcccccggccgcctcgggccctggcgacggccacctgtctcccagc
cagccccctttaaagaacctcttgtctcttctaaaggcctattacgctttgaatgcacag
cccagtgcagacgagctctccaaaattgccgactcggtgaacctgccgctggacgtcgtg
aagaagtggtttgagaagatgcaagcgggacagatctccgtgcagccttcggagccgccc
tctcccgaaccgggcaagggccccgtccctgcgaagaacgacgatcagcctcaacctgca
agtgcgagcgagccccaggccagcccgggcgacctccagagcccgctgaagacaaccggc
tctccggtcttacccgtggggtcggccgccggcggttccagaagtcggccgccctccccg
tcacccctcaacctctcctcccccagaagtacacagggttacttgtacgcggcagaaggg
gcgcaggaagagctccaagtagaacctcttgatctttcactaccaaagcagcagggagag
ttgttggaaaggtcaaccatcactagtgtttaccagaacagtgtttattctgtccaggag
gagcccttgaacttgtcttgtgcaaaaaaggagccacaaaaggacagctgtgtcacagac
tcagagccagttgtaaatgtagtcccaccaagtgccaaccccataaacattgctgtgccc
acagtcactgcccagttccccaccatcgtggccatcgctgaccagagcagtgtgccgtgc
ttgcgagcgcttgctgccaacaagcagaccatcctgatcccccaggtctcctacacgtac
tcgaccacggtcagccctgccgtccaggaaccgcccctgaaagtggtccagccaaacggg
aatcaggatgaaagacaagacactagctcagaaggggtgtccaacgtggaggatcagaac
gactcggactccacgccacccaagaagaagatgcggaagacggaaaacgggatgtacgcg
tgtgacctgtgcgataagatattccagaagagtagctcgttgctgaggcataaatacgag
cacacagggaagagaccccacgagtgtggaatctgtaaaaaggcctttaaacacaagcac
cacctgatcgaacacatgcgcctgcactcgggggagaagccctaccagtgtgacaagtgc
gggaagcgcttctcgcactcgggctcctactcgcagcacatgaaccaccgctactcctac
tgcaagagggaggccgaggagcgcgacgccgagcccggggagccgnngggggccgggccg
ggccccggccccggcgactcagacgacagggagagcttgacgcgggaggaggacgaggac
agcgacaaggaggaggaagaggaggaggagaaggagacggaggacctgcaggaagacaag
gaaagtggaaaagcgccaggcngagaggaggaggaggaggagatggaagagatggaggag
gaggaggagggagaaggagcaaaaactgaaggtgcgatggagggggcaggggccgccagc
cgagcgggcaccttagaaggcaaggtcagcgagggcagtgagccagcgtcggaagaaaaa
acaaatgaagcctaa

DBGET integrated database retrieval system