KEGG   Camelus dromedarius (Arabian camel): 105087582
Entry
105087582         CDS       T04642                                 

Gene name
ANGPTL4
Definition
(RefSeq) angiopoietin-related protein 4
  KO
K08767  angiopoietin-like 4
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105087582 (ANGPTL4)
  09154 Digestive system
   04979 Cholesterol metabolism
    105087582 (ANGPTL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105087582 (ANGPTL4)
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   105087582 (ANGPTL4)
SSDB
Motif
Pfam: Fibrinogen_C SlyX UPF0242 Spc7 Atg14 ADIP DUF16 Fib_alpha Guanylate_cyc_2 DivIC
Other DBs
NCBI-GeneID: 105087582
NCBI-ProteinID: XP_010976570
LinkDB
Position
22
AA seq 412 aa
MRGAPTAGAALVLCAATAGLLSAQGRPEPPEQPRFASWDEVNVLAHGLLQLGHGLREHVE
HTRGQLGALERRLSACGASCKEPEGAPAPPLVRASRAPPSGDVAPETLRSLQTQLKTQNS
RIQQLFQKVAQQQRHLEKQHLKIQNLQSQVGHLAPMHLGHGVAKPSRRKRLPKMAQLVGP
ARNISRLHRLPRDCQELFEEGERQSGLFQIQPQGSPPFLVNCNMTSDGGWTVIQRRQDGS
VDFNQPWAAYKDGFGDPQGEFWLGLEKVHRIMGDRGSRLSVQLQDWEGNAQSLQFPVHLG
GEDTAYSLQLTEPVASKLGATTIMPSGLSLPFSTWDQDHDLRQDKNCAKSLSGGWWFGTC
SHSNLNGQYFHSIPRQRQQRKKGIFWKTWRGRYYPLQATTMLIQPTAAEAAS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgcgcggtgcgccgacggccggagcagccctggtgctgtgcgccgccaccgccggcctg
ctgagcgctcagggccgcccggagccgcccgagcagccgcgcttcgcgtcctgggacgag
gtgaatgtgctggcgcacggactcctacagctcggccacgggctgcgcgagcacgtggag
cacacccgtgggcagctgggagcgctggagcggcgtctgagcgcgtgcggggcctcctgc
aaggagcccgagggggcccccgcgcctccgctcgtccgggcgagtcgggcccctcccagc
ggcgacgtcgccccagagaccctccgcagcttgcagactcagctcaagacccagaacagc
agaatccagcaactctttcagaaggtagcccagcagcagcggcaccttgagaagcaacac
ctgaaaattcagaatctgcagagtcaggtgggccacctggcccctatgcacctgggccac
ggggtggccaagccttccaggaggaagaggctacccaagatggcccagcttgttggacca
gcccgtaatatcagccgcctgcacagactgcccagggactgtcaggagctgttcgaagag
ggagagaggcaaagtggactgttccagatccagccccaggggtctccaccattcctggtt
aactgcaatatgacctcagatggaggttggaccgtaattcagaggcgccaggatggctcc
gtggactttaaccagccctgggcagcctacaaggatggctttggagacccccaaggtgaa
ttctggctgggcctggagaaggtgcaccgcatcatgggggaccggggcagccgcctgtct
gtgcagctgcaggactgggaaggtaatgctcagtcactgcagttccctgtccacctgggt
ggcgaggacacagcctacagcctgcagctcacggagcctgttgccagcaaattgggggcc
accaccatcatgcccagcggcctctccctgcccttctctacttgggaccaggaccacgac
ctccgccaggacaagaactgcgcaaagagcctctctggtggctggtggttcggcacctgc
agccactccaaccttaacggccagtacttccactccatcccacggcagcggcagcagcgt
aagaagggaatcttctggaagacctggcggggccgctactatccgctgcaggccaccacc
atgctgatccagcccacagcagctgaagcagcctcctag

DBGET integrated database retrieval system