KEGG   Camelus dromedarius (Arabian camel): 105087723
Entry
105087723         CDS       T04642                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04022  cGMP-PKG signaling pathway
cdk04024  cAMP signaling pathway
cdk04062  Chemokine signaling pathway
cdk04071  Sphingolipid signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04144  Endocytosis
cdk04150  mTOR signaling pathway
cdk04270  Vascular smooth muscle contraction
cdk04310  Wnt signaling pathway
cdk04350  TGF-beta signaling pathway
cdk04360  Axon guidance
cdk04510  Focal adhesion
cdk04520  Adherens junction
cdk04530  Tight junction
cdk04611  Platelet activation
cdk04621  NOD-like receptor signaling pathway
cdk04625  C-type lectin receptor signaling pathway
cdk04660  T cell receptor signaling pathway
cdk04670  Leukocyte transendothelial migration
cdk04722  Neurotrophin signaling pathway
cdk04810  Regulation of actin cytoskeleton
cdk04921  Oxytocin signaling pathway
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04972  Pancreatic secretion
cdk05100  Bacterial invasion of epithelial cells
cdk05132  Salmonella infection
cdk05133  Pertussis
cdk05135  Yersinia infection
cdk05152  Tuberculosis
cdk05163  Human cytomegalovirus infection
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    105087723 (RHOA)
   04015 Rap1 signaling pathway
    105087723 (RHOA)
   04310 Wnt signaling pathway
    105087723 (RHOA)
   04350 TGF-beta signaling pathway
    105087723 (RHOA)
   04072 Phospholipase D signaling pathway
    105087723 (RHOA)
   04071 Sphingolipid signaling pathway
    105087723 (RHOA)
   04024 cAMP signaling pathway
    105087723 (RHOA)
   04022 cGMP-PKG signaling pathway
    105087723 (RHOA)
   04150 mTOR signaling pathway
    105087723 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105087723 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105087723 (RHOA)
   04520 Adherens junction
    105087723 (RHOA)
   04530 Tight junction
    105087723 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105087723 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105087723 (RHOA)
   04621 NOD-like receptor signaling pathway
    105087723 (RHOA)
   04625 C-type lectin receptor signaling pathway
    105087723 (RHOA)
   04660 T cell receptor signaling pathway
    105087723 (RHOA)
   04670 Leukocyte transendothelial migration
    105087723 (RHOA)
   04062 Chemokine signaling pathway
    105087723 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    105087723 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    105087723 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    105087723 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    105087723 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    105087723 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    105087723 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105087723 (RHOA)
   05206 MicroRNAs in cancer
    105087723 (RHOA)
   05205 Proteoglycans in cancer
    105087723 (RHOA)
   05203 Viral carcinogenesis
    105087723 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105087723 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105087723 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105087723 (RHOA)
   05135 Yersinia infection
    105087723 (RHOA)
   05133 Pertussis
    105087723 (RHOA)
   05152 Tuberculosis
    105087723 (RHOA)
   05100 Bacterial invasion of epithelial cells
    105087723 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    105087723 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105087723 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105087723 (RHOA)
   04031 GTP-binding proteins [BR:cdk04031]
    105087723 (RHOA)
Membrane trafficking [BR:cdk04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    105087723 (RHOA)
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105087723 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   105087723 (RHOA)
  Exosomal proteins of colorectal cancer cells
   105087723 (RHOA)
  Exosomal proteins of bladder cancer cells
   105087723 (RHOA)
GTP-binding proteins [BR:cdk04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    105087723 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 105087723
NCBI-ProteinID: XP_031326175
LinkDB
Position
17
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgctatccggaagaaattggtgatagttggtgatggagcctgtggcaagacttgc
ttgctcattgtctttagcaaggaccagttcccggaggtgtatgtacctacggtatttgag
aactatgtggcagatattgaagtggatggaaagcaggtagagttggctttgtgggacaca
gctgggcaggaagattatgatcgcttgaggcccctctcctacccagataccgatgttata
ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact
ccggaagtcaagcatttctgtccgaacgtgcccatcatcctggttgggaacaagaaggat
cttcgaaatgatgagcatacaaggcgggagctagccaagatgaagcaggagccagtaaag
ccagaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgctca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacaagagctgctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system