KEGG   Camelus dromedarius (Arabian camel): 105087841Help
Entry
105087841         CDS       T04642                                 

Gene name
PLTP
Definition
(RefSeq) phospholipid transfer protein
  KO
K08761  phospholipid transfer protein
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105087841 (PLTP)
  09154 Digestive system
   04979 Cholesterol metabolism
    105087841 (PLTP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdk02000]
    105087841 (PLTP)
Transporters [BR:cdk02000]
 Other transporters
  Pores ion channels [TC:1]
   105087841 (PLTP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LBP_BPI_CETP_C LBP_BPI_CETP
Motif
Other DBs
NCBI-GeneID: 105087841
NCBI-ProteinID: XP_010976914
LinkDB All DBs
Position
19
AA seq 496 aa AA seqDB search
MALFGALVLALLAGAHAELPGCKIRITSKALDLVKQEGLRFLEQELETITIPDLRGREGH
FFYNISDVKVTELQLTSSELHFQPEQELMLQINNASLGLRFQRQLLYWFFYDGGYINTSA
EGMSIHTALQLSRDPTGRIKVSNVSCQASVSRMHAVFGGTFKKVYEFLSTFITSGMRFLL
NQQICSVLYHAGTVLLNSLLNTVPVRRAVDKLVGIDYSLLKDPVASTSNLDMDFRGAFFP
LAEGNWSLPNQAVEPQLLEEERMVYVAFSEFFFDSAMESYFRAGALQLLLVGDKVPHDLD
MLLRATYFGSIVLLSPAVIDSPLKLELRVIAPPRCTIKPSGTTISVTASVTIALVPPNQP
EVQLSSMTMDARLSAKMALRGKALRTQLDLRRFRIYSNQSALESLALIPLQAPLKTMLQI
GVMPMLNERTRRGVEIPLPEGINFVREVVTNHAGFLTIGADLHFAKGLREVIEKNQLTYT
RDPQASSAPSPSTAAV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggccctcttcggggctctcgtcctagcgctgctggcaggcgctcacgccgagctcccc
ggctgtaagatccgcatcacctctaaggctctggatctggtgaagcaggaggggctgcgc
tttctggagcaagagctggagaccatcaccattccggacctgcggggcagagagggccac
ttcttctacaacatctctgacgtgaaggtcacggagctgcagctgacatcctcagagctc
catttccagccagaacaagagctgatgctacaaatcaacaatgcctccttggggctgcgc
ttccagagacagcttctctactggttcttctatgatgggggctacataaacacctccgcc
gagggcatgtccatccacacggctctgcagctctcccgggatcccactggccggatcaaa
gtgtccaatgtctcctgccaggcctctgtctccagaatgcatgcagtctttgggggaacc
ttcaagaaggtatatgaattcctctccacatttatcacctcaggaatgcgcttcctcctc
aaccagcagatctgctccgtgctctaccacgcagggacagtgcttctcaactcccttctg
aacacggtgcctgtgcgcagagctgtggacaagctggtcggcattgactactccctcctg
aaggaccctgtggcctccaccagcaacctggacatggacttccggggggccttctttccc
ctggccgagggaaactggagcctgcccaaccaggcggtggagccccagctgctagaggaa
gagcggatggtgtatgtggccttctctgagttcttcttcgactctgccatggagagctac
ttccgggcaggggccctgcagctgttgctggtgggggacaaggtgccccacgatctggac
atgctgctgagggccacctactttgggagcatcgtcctactgagcccagcagtgatcgac
tctccgctgaagctagagctgcgagtcatagcgccacctcgctgcaccatcaagccctct
ggcaccaccatctccgtcactgccagtgtcaccatcgccttggtcccacccaaccagcct
gaggtccagctgtccagcatgaccatggatgcccgtctcagcgccaagatggcactccgg
gggaaggcgctgcgcacacagctggacctgcgcaggttccgaatctactcgaatcagtct
gcgctggagtcgctggcactgatcccgctgcaggcccctctgaagactatgctgcagatt
ggggtgatgcccatgctcaatgagcggaccaggcgtggggtggagattccactccctgag
ggtatcaactttgtgcgtgaggtggtgacgaaccacgcgggcttcctcaccatcggggcc
gatctccactttgccaaagggctgcgagaggtgattgagaagaaccagcttacttacacc
agggacccccaggcatccagtgccccatccccatccacggcagctgtctga

DBGET integrated database retrieval system