KEGG   Camelus dromedarius (Arabian camel): 105087845
Entry
105087845         CDS       T04642                                 

Gene name
MMP9
Definition
(RefSeq) matrix metalloproteinase-9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01522  Endocrine resistance
cdk04657  IL-17 signaling pathway
cdk04668  TNF signaling pathway
cdk04670  Leukocyte transendothelial migration
cdk04915  Estrogen signaling pathway
cdk04926  Relaxin signaling pathway
cdk05161  Hepatitis B
cdk05200  Pathways in cancer
cdk05202  Transcriptional misregulation in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05215  Prostate cancer
cdk05219  Bladder cancer
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    105087845 (MMP9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    105087845 (MMP9)
   04670 Leukocyte transendothelial migration
    105087845 (MMP9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    105087845 (MMP9)
   04926 Relaxin signaling pathway
    105087845 (MMP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105087845 (MMP9)
   05202 Transcriptional misregulation in cancer
    105087845 (MMP9)
   05206 MicroRNAs in cancer
    105087845 (MMP9)
   05205 Proteoglycans in cancer
    105087845 (MMP9)
  09162 Cancer: specific types
   05219 Bladder cancer
    105087845 (MMP9)
   05215 Prostate cancer
    105087845 (MMP9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105087845 (MMP9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    105087845 (MMP9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    105087845 (MMP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cdk01002]
    105087845 (MMP9)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     105087845 (MMP9)
Peptidases and inhibitors [BR:cdk01002]
 Metallo peptidases
  Family M10
   105087845 (MMP9)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 PT Reprolysin_4 DUF4953 Peptidase_M66 Reprolysin_3
Other DBs
NCBI-GeneID: 105087845
NCBI-ProteinID: XP_031289571
LinkDB
Position
19
AA seq 709 aa
MSPWQTLVLVLLVLRCCSAAPRPRQPTFVVFPGDQQTNLTNRQLAEEYLYRYGYTHVAEM
NEDEDSLRRALQRLQRRLALPETGELDTTTLNAIRAPRCGVPDVGKFLTFEGDLKWHHQN
ITYWIQNYSEDLPRDVIDDAFARAFALWSAVTPLTFTRVYGREADIVIQFGVREHGDGYP
FDGKDGLLAHAFPPGGGIQGDAHFDDEELWSLGKGVVVPTYFGNANGTACHFPFTFEGRS
YSACTTDGRSDDMLWCSTTADYDTDRKFGFCPSERLHTRDGNADGKPCVFPFTFEGRSYS
ACTTDGRSDGYRWCATTANYDQDKLYGFCPTRADSTVTGGNSAGELCVFPFTFLGKEYST
CTREGRNDGHLWCATTSNFDRDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYSYTEENPLHEDDVRGIQYLYGSRPKPEPRPPTTTTAEPQPTAPPTVCVTGPPTTRPS
EGPTAGPTGPPSAGPTGPPTAGPSAAPTAPLDPAEDVCKVEIFDAIAEIGNRLHFFKDGR
YWRLSERGGRWVQGPFLIKNTWPALPRKLDSAFEEPLTKKIFFFSGRKVWVYTGESVLGP
RRLDKLGLGPEVPQVTGALPRAEGKVLLFSRQNFWRFDVKTQKVDPRSATPVDQMFSGVP
LNTHDIFQYQEKAYFCQDRFYWRVSSRNEVNQVDYVGYVSFDLLQCPED
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgagcccctggcagaccttggttctggtgctcctggtgctgcgctgctgctctgccgcc
cccagaccacgccagcccacctttgtggtcttcccaggagaccagcaaaccaatctcacc
aacaggcagctggcagaggaatatctataccgctatggctacactcacgtggcagaaatg
aatgaggacgaggactccttgcgacgggcactgcaacgtctccagcggcgcctggccctg
ccagagactggcgaactggacaccaccaccctgaatgccattcgtgccccgcgctgtggc
gtcccagacgtgggcaaatttctgacctttgagggtgacctcaagtggcaccaccaaaac
atcacctactggatccaaaactactcggaagacttgccgcgcgatgtgatcgacgacgcc
tttgcccgtgccttcgcgctctggagcgccgtgacgccgctcacctttactcgcgtgtac
ggccgcgaagctgacatcgtcatccagtttggtgttagggaacacggagatgggtatccc
ttcgatggtaaggacgggctcctggcacacgcctttcctcctggagggggcattcaggga
gacgcccacttcgatgatgaagagttgtggtccctgggcaagggcgtcgtggttccgacc
tacttcggaaacgcaaatggcaccgcctgccacttccccttcaccttcgaaggccgctcc
tactcggcctgcactacggacggccgctccgacgacatgctctggtgcagcaccacggcc
gactatgacacagaccgcaagttcggtttctgccccagcgagagactccacacccgggac
ggcaatgccgacggcaagccctgcgtgtttccgttcactttcgagggccgctcctactct
gcctgcaccaccgacggtcgctcggacggctaccgctggtgcgccaccaccgccaactac
gatcaggacaagctctatggcttctgtcctacccgagccgactcgacggtgactgggggc
aactcggcgggagagctgtgcgtcttccccttcaccttcctgggcaaggagtactcgacc
tgcaccagagagggccgcaatgatgggcacctctggtgtgccaccacctcgaacttcgac
agagacaagaagtggggcttctgcccagaccaaggatacagcctgttccttgtggctgca
cacgagttcggccacgctctgggcttagatcactcgtctgtgccagaggcgctcatgtac
cccatgtacagctacactgaggagaaccccctgcatgaggacgatgtgaggggcatccag
tatctgtatggttctcgccctaaacctgaaccacggcctccaaccaccaccacagctgaa
ccccagcccacggctcccccgacggtctgcgtcaccgggcctcccactacccgcccctca
gagggccccactgctggccccacaggccccccttcagctggtcccacaggtccccccact
gctggcccttctgcggcccctacagcgcccttggatccagcagaggatgtctgcaaagtg
gagatcttcgatgccatcgccgagatcggcaatcgtctgcatttcttcaaggacgggagg
tactggagactctctgagcgcgggggacgctgggtgcagggccccttccttatcaagaac
acgtggcctgcgctgccccgaaagctagactctgcatttgaggagccactcaccaagaag
attttcttcttctctgggcgcaaagtgtgggtgtacacaggcgagtcggtgctaggcccg
aggcgtctggacaagctaggcttgggaccggaggtgccccaggtcaccggggccctcccg
cgcgccgagggtaaggtgttgctgttcagcaggcagaacttctggaggttcgatgtgaag
acgcagaaagtggatccccggagcgccacccccgtagaccagatgttctccggggtgccc
ttgaacactcacgacatcttccagtaccaagagaaagcttacttctgccaggaccgcttc
tactggcgtgtgagttcccggaatgaggtgaaccaggtggactatgtgggctacgtgtcc
tttgatcttctgcagtgccccgaggactag

DBGET integrated database retrieval system