KEGG   Camelus dromedarius (Arabian camel): 105088051Help
Entry
105088051         CDS       T04642                                 

Gene name
KMT2B
Definition
(RefSeq) lysine methyltransferase 2B
  KO
K14959  histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    105088051 (KMT2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105088051 (KMT2B)
   03036 Chromosome and associated proteins [BR:cdk03036]
    105088051 (KMT2B)
Enzymes [BR:cdk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105088051 (KMT2B)
Transcription factors [BR:cdk03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    105088051 (KMT2B)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105088051 (KMT2B)
   HMT complexes
    MLL3/MLL4 complex
     105088051 (KMT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET FYRC PHD FYRN zf-CXXC zf-HC5HC2H zf-HC5HC2H_2 Bromodomain PHD_2
Motif
Other DBs
NCBI-GeneID: 105088051
NCBI-ProteinID: XP_010977134
LinkDB All DBs
Position
Un
AA seq 2324 aa AA seqDB search
VLQEHGETPICNKLPSPPLTPPAPPPPPSLPPPSTSPPVPLCPPPPPVSPPPPPSPPLPP
APEEQEESPPPVAPATCSRKRGRPPLTPSQRAEREAARAGPEGTSPPTAVPSTTTGGPLE
DSPTMAPKSTTFLKNIRQFIMPVVSARKSVIKTPRRFMDEDPPKPPKVEVSPTLRPPVAT
SPLTPQEPAPAPSPPRAPTPPPTPVPLPLPEKRRSILREPTFRWTSLTRELPPPPPAPPP
APPPPXLRAPQFTPSEAHLKIYESVLTTPPLGAPEAPEPEPPPADDSPAEPEPRAVGRTN
HLSLPRFVPVVATPVKAEVPPPGPPAPSSGQQPQAQLQQPLQALPTPLLPQTQPPQQPQL
QPQLQLQPPPPQQPPPPEKARIPGLGSLPLSGVEEKMFSLLKRAKVQLIKIDQQQQQQKV
ASLMPPSPGGQMEEAVGTVKQIPDRGSVKSEDESMETKRERPSGPESPVQGPRIKHVCRH
AAVALGQARAMVPEDVPRLSALPLRDRQDLATEDTSSASETESVPSRSRRGKVESAGPGG
DSEPAGSGGTLAHAPRRSLPSHHGKKMRMARCGHCRGCLRVQDCGSCVNCLDKPKFGGPN
TKKQCCVYRKCDKIEARKMERLAKKGRTIVKTLLPWDSDESPEASPGPPGPRRGAGAGGP
REEVVAPQGPEEQDSLLLQRKSARRCVKQRPSYDIFEDSDDSEPGGPPAPRRRTPRENEL
PVLEPEEQSRPRKPTLQPVLQLKARRRLDKDALAPGPFASFPNGWTGKQKSPDGVHRVRV
DFKEDCDLENVWLMGGLSVLTSVPGGPPMVCLLCASKGLHELVFCQVCCDPFHPFCLEEA
ERPLPQHHDTWCCRRCKFCHVCGRKGRGSKHLLECERCRHAYHPACLGPSYPTRATRKRR
HWICSACVRCKSCGATPGKNWDVEWSGDYSLCPRCTQLYEKGNYCPICTRCYEDNDYESK
MMQCAQCDHWVHAKCEGLSDEDYEILSGLPDSVLYTCGPCAGATHPRWREALSGALQGGL
RQVLQGLLSSKVAGPLLLCTQCGQDGKQLHPGPCDLHAVSQRFEEGHYKSVHSFMEDVVG
ILIRHSEEGETAERRAGGQTKGLLLKLLESAFGWFDAHDPKYWRRSTRLPNGVLPNAVLP
PSLDHVYAQWRQQEPETPESGQPPGDPSTAFQGKDSAAFSHLDDPRQCALCLKYGDADSK
EAGRLLYIGQNEWTHVNCAIWSAEVFEENDGSLKNVHAAVARGRQMRCELCLKPGATVGC
CLSSCLSNFHFMCARASYCIFQDDKKVFCQKHTDLLDGKEIVTPDGFDVLRRVYVDFEGI
NFKRKFLTGLEPDAINVLIGSIRIDSLGTLSDLSDCEGRLFPVGYQCSRLYWSTVDARRR
CWYRCRILEYRPWGPREEPVHLEAAEENQTIVHSPAPSSEPPDHVDPPPDTDALIPRAPE
HHSPVQSLDPTLRPDPSSAPPPAPRSFSGARIKVPNYSPSRRPLGGVSFGPLPSPGSPSS
LTHHIPTVGDLDFPAPPRRSRRPSPLAPRLPPSRRASPPLRTSPQLRVPPPTSVVRALTP
TSGELAPPGRAPSPPPPPEDLGPDFEDMEVVSGLSAADLDFAASLLGTEPFQEEIVAAGA
VGSSHGGPGDHSSEEEASPTPRYVHFPVTVVSGPALAPGALPGAPRIEQLDGVDDGTDSE
AEAVQQPRGQGTPPSGPGAGRAGVIGAAGDRARPPEDLPSEIVDFVLKNLGGPGEGGAGP
REEPLPPAPPLANGSQPPQGLPPSPADPTRTFAWLPGAPGVRVLSLGPAPEPPKPATSKI
ILVNKLGQVFVKMAGEGEPVSPPVKQPPLPPAIPPTAPASWTLPPGPLLGVLPVVGVVRP
APPPPPPPLTLVLSSGPPSPPRQAIRVKRVSTFSGRSPPAPPPSKTPRLEEDGDSLEDHP
QGPGLCGIGSSRVRMKTPTVRGVLDLDDPGEPAVGESPRPLQDRSPLLPLPEIGPPRAPD
GPPDLLLESQWHHYSGEASSSEEEPPSPEDKENQAPKRAGPHLRFEISSEDGFSVEAESL
EGAWRTLIEKVQEARGHARLRHLSFSGMSGARLLGIHHDAVIFLAEQLPGAQRCQHYKFR
YHQQGEGQEEPPLNPHGAARAEVYLRKCTFDMFNFLASQHRVLPEGATCDEEEDEVQLRS
TRRATSLELPMAMRFRHLKKTSKEAVGVYRSAIHGRGLFCKRNIDAGEMVIEYSGIVIRS
VLTDKREKFYDGKGIGCYMFRMDDFDVVDATMHGNAARFINHSCEPNCFSRVIHVEGQKH
IVIFALRRILRGEELTYDYKFPIEDASNKLPCNCGAKRCRRFLN
NT seq 6976 nt NT seq  +upstreamnt  +downstreamnt
cgtgctgcaggagcatggagagacccccatttgtaacaagctgccatcaccacccctgac
tcctccagcccctccacctcctccatccctcccacctccctcaacatctcccccggtccc
actttgccctccaccacccccagtgtctcctccacccccaccatcccctccactgcctcc
tgccccagaggagcaggaagaatcccctcctcctgttgccccagctacatgctccaggaa
gaggggccggcctcccctgactcccagccagcgagcagagcgggaagctgctcgggcagg
gccagagggcacctctcctcccactgcagtccccagcaccaccacaggaggccctctgga
agacagccccactatggcccccaaaagtaccacctttctgaagaacatccggcagtttat
tatgcctgtggtgagtgcccgaaaaagtgtcatcaagacaccccggcgatttatggatga
agacccacccaaacccccaaaggtagaggtctcacccactctacggcctcccgttgccac
ctccccactcaccccccaggaaccagcaccagccccctctccgccgcgtgccccaactcc
tccacctaccccagtcccactcccactccctgagaagagacggtccatcctaagggaacc
tacatttcgctggacctccctgacccgggaactgccccctcctcctcctgcccctccacc
agccccacccccacctnnccttcgagcccctcagtttaccccaagtgaagcccacctgaa
gatctacgaatcggtgcttactactcctcctcttggggcccctgaagcccctgagccaga
gcctcctcctgccgatgactctccagctgaacctgagccacgggcagtgggccgcacgaa
ccacctcagcttgcctcgatttgtccctgtggtcgccactcctgttaaggccgaggtgcc
ccctcctgggcctccagctccaagcagtgggcagcagcctcaggctcagctgcagcaacc
cctgcaggccttgccaactccactgctgccccagacacagccaccacagcagccacagct
gcaaccacagttacagctgcagccgccgccaccacagcagcctccgccaccagaaaaggc
ccggatcccaggccttggttccttaccactgtctggtgtggaggagaagatgttcagcct
cctcaagagagccaaagtgcagctaatcaagattgaccagcagcagcagcagcaaaaggt
ggcgtctctgatgccgccgagccctggagggcagatggaggaggccgtggggactgtcaa
gcagatcccagatagaggttctgtcaagtccgaagatgaatcgatggaaactaagagaga
gaggccatcgggccctgagtcccctgtgcaaggcccccgcatcaaacatgtctgccgtca
tgctgctgtggccctgggtcaggcccgggccatggtgcccgaagacgtcccccgcctcag
tgctctccctcttcgagatcggcaggacctcgccacggaggatacgtcatcagcatctga
gactgagagtgtcccatctcggtcccggcggggaaaggtggagtcagcagggcctggggg
agactcagagcctgcagggtctggagggaccctggcccatgcaccccggcgctcactgcc
ctcccatcatggcaagaagatgcggatggcacggtgtggacactgtcggggctgcctgcg
tgtgcaggactgtgggtcctgtgtcaactgcctggacaagcccaagtttgggggccccaa
caccaagaagcagtgctgtgtataccggaagtgcgacaagatagaggctcggaagatgga
acggctggccaaaaaaggccggacgatagtgaagacgctgttgccctgggattccgatga
atctcctgaggcctcccctggtcctccaggcccacgccggggggcgggagctggggggcc
ccgggaggaggtggtggccccccaagggcccgaggagcaggactccctcctactgcagcg
caagtcagcccggcgctgcgtcaaacagcgaccctcctatgatatcttcgaggactcgga
tgactcagagcccgggggtcctcctgctcctcggcgtcggaccccacgagagaatgagct
gccagtgctggaacctgaggagcagagccggccccgcaaacctaccttgcagcctgtgtt
gcagctcaaggctcggaggcgcctggacaaggatgctttggcccctggtccctttgcttc
ttttcccaatggctggactggaaaacaaaagtcccctgatggcgtgcaccgggttcgtgt
ggattttaaggaggattgtgacctggagaacgtgtggctgatgggcggcctgagtgtact
tacctccgtgccaggggggccaccgatggtgtgcttgctgtgtgccagcaaaggcctaca
tgagctggtgttctgccaagtctgctgtgaccctttccacccattctgcctggaggaggc
cgagcggcccctgccccaacatcatgacacctggtgctgtcgccgctgcaagttctgcca
tgtttgtgggcgcaaaggccggggatccaagcacctcctggagtgtgagcgctgccgcca
tgcttaccacccagcctgcctggggcccagctacccaacccgggccacacgcaaacggcg
ccactggatctgctcagcctgcgtgcgctgtaagagctgtggagcaactccaggcaagaa
ctgggacgtcgagtggtcgggagattacagcctctgccccaggtgcacccagctctatga
gaaaggaaactactgcccgatctgcacacgctgctatgaagacaacgactatgagagcaa
aatgatgcagtgtgcacagtgtgaccactgggtgcacgccaagtgcgaggggctctcaga
tgaagactatgagatcctttcggggctgccagactcggtgctgtacacctgtggaccatg
tgctggggccacacacccccgctggcgagaggccctgagtggggccctgcagggaggcct
gcgccaggtgctccagggcctgctgagctccaaggtggcaggcccactgctgctgtgcac
ccagtgtgggcaggatggaaagcagctgcacccagggccctgtgatctgcatgctgtgag
ccagcgcttcgaggagggccactacaagtccgtgcacagcttcatggaggatgtggtggg
catcctgataaggcactcagaagagggagagaccgcggagcgccgggctggaggccagac
aaaggggctcctactgaagctgctagagtctgcgttcggctggttcgacgcccatgaccc
caagtactggcgacggagtacccggctgcccaacggagtccttcccaatgccgtgttgcc
cccatccctggaccatgtctatgctcagtggaggcagcaggaaccagagaccccggaatc
agggcagcctccaggggacccctcaacagccttccagggcaaggattcagctgctttctc
acacctggacgacccccgtcagtgtgcactctgcctcaaatatggggatgcagattctaa
ggaggcagggcggctcctgtacatcgggcagaacgagtggacacacgtcaactgtgccat
ttggtcagccgaagtgtttgaagaaaatgatggctccctcaagaacgtacacgctgctgt
ggctcgaggaaggcaaatgcgctgtgagctctgcctgaagcctggagccacggtgggctg
ctgcctttcctcctgcctcagcaacttccactttatgtgtgcccgggccagctactgcat
cttccaggatgacaagaaagttttctgccagaagcacacagacctgctggatggcaagga
gatcgtgacccctgatggttttgatgttctccgccgagtctatgtggactttgagggcat
caacttcaagcgaaagttcttgacgggacttgaacctgatgccatcaatgtgcttattgg
ctccatccgaatcgactccttgggcactctgtctgatctctctgactgcgagggacgcct
cttccccgttggctaccagtgctcccgtctgtactggagcacggtagatgctcggcggcg
ctgctggtatcggtgccgaattctggaatatcggccatgggggccaagggaagagccggt
tcacctggaggcagcagaggagaaccagaccattgtgcacagccccgccccttcctcaga
gcccccagatcatgtggaccccccaccagatacagatgcccttatccctagagctcctga
gcaccactcacccgttcagagcctggaccccacacttcggccggatccaagcagcgcccc
tcctccagcccctcgctccttttcgggggctcgaatcaaagtgcccaactactcaccatc
ccggaggcccttggggggtgtctcctttggacccctgccctcccctggaagtccatcttc
tctgacccaccacatccctacagtgggagacctggacttcccagctccccccagacgctc
ccgtcgtcccagccccctggcccctaggctgccaccatcacggcgggcctctccccctct
cagaacctctcctcagctcagggtgccccctcctacctcagttgttagagcgctcacacc
tacctcaggggagctggctccccctggccgggccccatctcctcctccaccccctgaaga
cctgggcccagactttgaggacatggaggtggtgtcaggactgagtgctgctgacctgga
ctttgcggccagcctgctggggactgagcccttccaggaagagattgtggccgcaggggc
agtggggagcagccacgggggccccggagaccacagctcagaggaggaggccagccccac
cccccgctatgtccacttccctgtgactgtggtgtccggccctgcgctggctcctggagc
cctccctggagccccccgcattgaacagctggatggagtggatgacggcacagacagcga
ggctgaggcagtccagcagcctcggggccagggaactcctccttcagggccaggagccgg
ccgggctggggtcattggggctgcaggggacagagcccgacctcctgaggacttgccatc
agaaattgtggattttgtgttgaagaacctaggggggcctggggaggggggtgctgggcc
cagagaggagccactccccccagcacctcccctggccaatggcagccagccccctcaggg
cctgccccctagcccagctgaccccacccggacgtttgcctggctccctggggctccagg
ggtccgggtattgagcctgggccctgcccctgagccccctaaacccgcgacatccaagat
catccttgtcaacaagctggggcaagtgtttgtgaagatggctggggagggtgaacctgt
ctcacccccagtgaagcaaccacctctgccccctgccatcccccccaccgcccctgcatc
ctggactctgcccccaggacccctgctgggggtgttgccagtggtaggggtggtccgtcc
tgccccgcccccacccccacctccattgacgctggtgttgagcagtgggccccccagccc
accccggcaggccatccgcgtcaaaagggtgtccaccttctctggccgttccccaccagc
gcctcccccaagcaagactccccggctggaggaagatggagattccttggaggaccaccc
ccagggtccagggctttgtggcattgggtctagccgagtgaggatgaaaacgcccactgt
gcgtggagttctcgacctggatgatcctggggagcccgctgtgggggaaagcccacggcc
cctccaggaccggtcccctctgctgccactcccagaaattggtcctccccgggcccccga
tggtcctcccgacctgctgcttgagtcccagtggcaccactactcaggtgaggcttcaag
ctctgaagaagagcctccgtccccagaagacaaagagaaccaggctcctaaacgagctgg
cccacatctccgtttcgagatcagcagtgaggatgggttcagcgtggaggcagagagctt
ggagggggcgtggagaactctgattgagaaggtgcaagaggcccgaggacatgcccggct
cagacatctctcctttagtggaatgagtggggcaaggctcctgggcatccaccacgatgc
tgtcatcttcctggcagagcaactgcctggagcccagcgctgtcagcactataagttccg
ctaccaccagcagggagagggccaggaggagccacccctgaatccccatggggctgcccg
cgctgaggtctatctccggaagtgcacctttgacatgttcaatttcctggcctcccagca
ccgggtgctccctgagggagccacctgtgatgaggaagaggatgaggtgcagctcaggtc
aaccagacgcgccacgagtctggagctgcccatggccatgcgctttcgccacctcaagaa
gacatccaaagaggctgtgggtgtctacagatctgccatccatgggaggggactgttctg
taagcgcaacattgacgctggcgagatggtcattgagtactctggtattgtcattcgctc
tgtgctgactgacaagcgggagaagttctatgatgggaagggcattggatgctacatgtt
ccgcatggatgactttgacgtggtggatgccaccatgcatggcaatgccgcccgcttcat
caaccactcctgtgagcccaactgcttctctcgagtcatccacgtggagggccagaagca
catcgtcatcttcgccctgcgccgcatcctgcgtggtgaggagctcacctatgactacaa
gttccccattgaggatgccagcaacaagctgccctgcaactgtggcgccaagcgctgccg
tcggttccttaactga

DBGET integrated database retrieval system