KEGG   Camelus dromedarius (Arabian camel): 105088198
Entry
105088198         CDS       T04642                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00220  Arginine biosynthesis
cdk00330  Arginine and proline metabolism
cdk01100  Metabolic pathways
cdk04020  Calcium signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04146  Peroxisome
cdk04371  Apelin signaling pathway
cdk04926  Relaxin signaling pathway
cdk05010  Alzheimer disease
cdk05014  Amyotrophic lateral sclerosis
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05133  Pertussis
cdk05140  Leishmaniasis
cdk05142  Chagas disease
cdk05145  Toxoplasmosis
cdk05146  Amoebiasis
cdk05152  Tuberculosis
cdk05200  Pathways in cancer
cdk05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    105088198 (NOS2)
   00330 Arginine and proline metabolism
    105088198 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    105088198 (NOS2)
   04066 HIF-1 signaling pathway
    105088198 (NOS2)
   04020 Calcium signaling pathway
    105088198 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105088198 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    105088198 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105088198 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    105088198 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105088198 (NOS2)
   05014 Amyotrophic lateral sclerosis
    105088198 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    105088198 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    105088198 (NOS2)
   05152 Tuberculosis
    105088198 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    105088198 (NOS2)
   05145 Toxoplasmosis
    105088198 (NOS2)
   05140 Leishmaniasis
    105088198 (NOS2)
   05142 Chagas disease
    105088198 (NOS2)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     105088198 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 105088198
NCBI-ProteinID: XP_010977304
LinkDB
Position
16
AA seq 1157 aa
MACPWKFLFRTKSNQFDLTEELDINNNVQKACQVPSSPVTQDDPKSHSLSKHRDESPWPL
TGAVKKSPESLVKLDASLWASPQHVRIKNWGSGMTFHDTLHQKAKRDLACKSKSCLGAVM
NPKSLTIGPRDKPTSPDELLPQAIEFVNQYYSSFKEAKIDEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGTIRGDPASVEFTQLCINLGWKPKYG
RFDVVPLVLQANGRDPELFEIPPDLVLEVPMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKVASLWKDRAVVEINV
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWVWLVPPISGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDERRRPRRREIRFKVLVKAVLFTSVLMCKTMASRVRAT
ILFATETGRSETLAGDLGALFSCAFNPKVLCMDEYSLSHLEEEQLLLVVTSTFGNGDSPG
NGEKLKKSLFMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPIGEGD
ELSGQEEAFRSWAMQTFKAACETFDVRGKHHIQIPKLYTSSVTWDPHHYRLVQDSQPLDL
SKALSSMHAKHVFTMRLKSRQNLQSPKSSRTTLLVELSCEGSQGLSYLPGDHLGVFPGNQ
PALVQGILERVVDGPAPHQPMRLETLSENGSYWVQDKRLPPCSLSQALTYFLDITTPPTQ
LLLRKLALLATEEAERQKLEALCQPSEYNKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRYYSISSSRDCTPTEIHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDLVPCF
VRSASGFQLPEDPSRPCILIGPGTGIAPFRSFWQQRLHDAEHKGLQGGHMTLVFGCRRPD
EDHLYREEMLELARKGVLHEVHTAYSRLPGQPKVYVQDILRRQLAGEVLRVLHEEQGHLY
VCGDVRMARDVACTLKQLVAAALTLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYELKKDG
SAGPPSDPQAPVAWRRS
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggcctgtccctggaagtttctgttcaggaccaaatccaaccaatttgatttgactgag
gaattggacattaacaacaacgtgcagaaagcctgccaggttccctccagtccagtgaca
caggatgaccccaaaagtcacagcctcagcaagcaccgggatgagtccccctggcccctc
acgggggcggtaaagaaatctccagaatccctggtcaagctggatgcatccctatgggcc
agcccacagcatgtgaggatcaaaaactggggcagcgggatgactttccacgacacactt
caccaaaaagccaaacgggatctcgcttgcaagtccaagtcttgcctgggagccgtcatg
aaccccaaaagtttgaccataggacccagggacaagcctacctccccagatgaacttcta
cctcaagctatcgaatttgtcaaccagtattacagctccttcaaagaggcaaaaatagat
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccag
ctgacaggagatgagctcatctttgccaccaagcaggcctggcgcaacgccccccgctgc
atcggcaggatccagtggtccaacctgcaggtcttcgacgcccggagctgttctactgcc
caggaaatgttcgagcacatctgcagacacctgcgttactcgaccaacaacggcaacatc
aggtcggccatcaccgtgtttccccagcggagcgatgggaagcacgacttccgagtctgg
aatgctcagctcatccggtatgccggctaccagatgcctgatggcaccatcaggggggac
cctgcctccgtggagttcacccagctgtgcatcaacctaggctggaagcctaagtacggc
cgcttcgatgtggtgcctctggtcctgcaggctaatggccgcgaccctgagctcttcgaa
atcccacctgaccttgtgctcgaggtgcccatggaacatcccaagtacgagtggttccgg
gagctggagctaaagtggtatgccctgccggctgtggccaacatgctgctggaggtgggt
ggtcttgagttcccaggatgccccttcaacggctggtacatgggcacggagatcggggtc
cgggacttctgtgacgtccagcgctacaacatcctggaggaagtgggcagaaggatgggc
ctggaaacacacaaggtagcctcactctggaaggaccgggctgtcgttgagatcaacgtt
gctgtgctccacagtttccagaagcagaatgtgaccatcatggaccaccactcagctgca
gaatccttcatgaagtacatgcagaatgaataccggtcccgagggggctgcccggcggac
tgggtttggctggtccccccgatttctggaagcatcacccccgtattccaccaggagatg
ttaaattatgtcctgtcccctttctactactaccaggtggaggcctggaaaacccacgtc
tggcaagatgagaggaggagaccccggagaagagagattcgattcaaagtcttggttaaa
gccgtgctcttcacctcagtgctgatgtgtaagaccatggcgtcccgggtcagagccaca
atcctctttgcaacggagacgggaagatcggaaacgctggccggggacctaggggccttg
ttcagctgtgccttcaaccccaaggttctctgcatggacgagtacagcctgagccacctg
gaggaggagcagctgctgctggtggtgaccagcacgtttgggaatggagactcccctggc
aacggagagaaactgaagaagtccctcttcatgctgaaagaactcaccaacaagttcagg
tatgctgtgtttggccttggctccagcatgtaccctcagttctgtgcctttgctcatgac
atcgaccagaagttgtcccacctgggggcttctcagctagccccaataggagaaggggac
gagctcagcgggcaggaggaggccttccgcagctgggccatgcaaaccttcaaggcggcc
tgtgagacgttcgatgtccgaggcaaacaccacattcagatccccaagctctacacgtcc
agtgtgacctgggacccacaccactacaggctcgtgcaggactcacagcctttggacctc
agcaaagccctcagcagcatgcacgccaagcatgtgttcaccatgaggctcaaatcacgg
cagaatctacagagtccgaaatccagccgcaccaccctcctggtggaactctcttgtgag
ggcagccaaggtctgagctacctgccaggagatcacctcggagttttcccgggcaaccag
ccggcccttgtccaaggcatcttggagcgagtggtggacggccctgcaccccaccaaccc
atgcgcctggagaccctcagcgagaacggcagctactgggtccaggacaagcggctgccc
ccctgctcactcagccaggccctcacctacttcctggacatcaccacacccccaacccag
ctgctgctccgaaagctggccctgctggctacagaagaggcagagaggcagaaactggag
gccctgtgccagccctcagagtacaacaagtggaagttcaccaatagccccacattcctg
gaggtgctggaggagttcccgtctctgcgggtgtctgctggcttcctgctctcccagctc
cctattctgaagccccggtactactccatcagctcctccagggactgcacacccacggag
atccacctcaccgtggctgtgctcacataccgcacccgagatggccagggtcccctgcac
catggtgtctgcagcacatggcttagcagcctgaagccccaagacctggtgccctgcttt
gtgcgaagtgccagtggcttccagctgcctgaggacccctcccgtccttgcatcctcatc
gggcctggcacgggcatcgcccccttccgcagtttctggcagcagcggctccatgatgct
gagcacaaagggctccagggtggccacatgaccctggtgttcgggtgccgccgcccggat
gaggaccatctctacagggaggagatgttggagttggcccggaagggggtgctgcatgag
gtgcacacggcctattctcgcctgcctggccagcccaaggtttacgttcaagacatcttg
cggcggcagctggccggtgaggtgctccgcgtgctccatgaggagcaaggccacctctat
gtctgtggcgatgtgcgcatggcccgtgatgtggcctgcaccctgaagcagctggtggct
gccgcgctgaccctgaacgaggagcaagtggaggactatttctttcagctgaagagccag
aagcgctaccatgaagatatctttggtgctgtatttccctacgagctaaaaaaggatggg
tcagcagggccgcccagtgatccccaagctcccgtagcctggaggagaagttaa

DBGET integrated database retrieval system