KEGG   Camelus dromedarius (Arabian camel): 105088231Help
Entry
105088231         CDS       T04642                                 

Gene name
LIG3
Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03410  Base excision repair
Module
cdk_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    105088231 (LIG3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cdk03400]
    105088231 (LIG3)
Enzymes [BR:cdk01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     105088231 (LIG3)
DNA repair and recombination proteins [BR:cdk03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     105088231 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C BRCT_2 RNA_ligase mRNA_cap_enzyme Synaptonemal_3
Motif
Other DBs
NCBI-GeneID: 105088231
NCBI-ProteinID: XP_010977340
LinkDB All DBs
Position
Un
AA seq 999 aa AA seqDB search
MILAFKILFPPTLRALSRKELCLFREHHRPDIRQFSQWSETDLHGHRLLQRKKPVLSFQE
GSLRPRATCLVSLPGSHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRIGK
VVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQISQHI
ADLSSKAAGTPKKKAIVQAKLTATGQVTSPVKSASFVTNTNPRKFSGFSAKPNNSGEARS
SPAPKTSLSSSKCDPKHKDCLLREFRKLCAMVAENPSYNTKTQIIQDFLQKGSAGDGFHG
DVYLTVKLLLPGVIKSVYNLNDKQIVKLFSRIFNCNSDDMARDLEQGDVSETIRVFFEQS
KSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDLK
MNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLRNEQEVEKEPGQRRALSVQASLMTPV
QPMLAEACKSIEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVAHF
KDYIPQAFPGGHSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIFFN
DVSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKQVTKASDLADMINRVIQEGLEGLVLKD
VRGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPSSQ
KWCTVTKCAGGHDDATLARLQKELDMVKISKDPSKIPNWLKINKIYYPDFIVPDPKKAAV
WEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKERAAFTLV
AGDEGSSTTGGSSGENEGTSGPAVSHKAPRASPKRPSASAKKAGEKLSGSDGRGGTKLAA
KPSPVKVGEKRKAPDETPCQAKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAFDGDLVQEF
DMASATHVLGSRDKNPEAQQVSPEWIWACIRKRRLVAPC
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atgattttggcttttaagatcctcttcccaccaactctccgtgcactcagccgaaaagaa
ttgtgcctattccgagaacatcaccggcctgacataagacagttcagccagtggtcagaa
acagatcttcatggacaccgcctcctccagagaaaaaagcctgttctgtcattccaggaa
ggcagtctaagaccacgtgccacctgccttgtttccttgccagggtcgcatgtgggactc
tgcagtggcccctgtgagatggcagagcaacggttctgtgtggactatgccaaacgtggc
acagctggctgcaaaaaatgcaaggagaagattgtcaagggcgtatgccgaatcggcaaa
gtggtgcccaatcccttctcagagtcggggggcgatatgaaagagtggtaccacattaaa
tgcatgtttgagaaactggaacgggcccgggccaccacaaaaaaaattgaggacctcaca
gagctggaaggctgggaagagctggaagataatgagaaagaacagataagccagcacatt
gcagatctgtcttccaaggcagcaggcacaccaaagaagaaagccattgtccaggctaag
ttgacagccactggccaggtgacatctccagtgaagagtgcctcatttgtcaccaatacc
aatccccggaaattttctggcttttcagccaagcccaacaactctggggaagcccgctca
agccctgcccctaagacaagtctgtcctccagcaaatgtgaccccaagcacaaggattgt
ctgctacgcgagtttcggaagttgtgtgccatggtggctgaaaatcctagctacaacacg
aagacccagatcattcaggacttccttcagaaaggctcagcaggagatggtttccacggt
gacgtgtacctaacagtgaagctgttgctgccgggtgttattaagagtgtttacaacttg
aatgacaagcagattgtgaagcttttcagccgcatttttaattgcaactcagatgatatg
gcacgagacctagagcagggtgacgtgtcagagacaatcagagtcttctttgagcagagc
aagtctttccccccagctgccaagagcctccttaccatccaggaggtggacgaattcctc
ctgcgactctccaagctcaccaaggaggatgagcaacaacaggcccttcaggacatcgcc
tccaggtgtacagccaatgaccttaagtgcatcatcaggttgatcaagcatgatctgaag
atgaactcaggtgcaaaacatgtgttagatgccctcgaccctaatgcctatgaagccttc
aaagcctcgcgcaacctgcaggatgtggtggagcgggtgctccgcaacgagcaggaggtg
gagaaggagccaggccagagacgagctctgagtgtccaggcctcactgatgaccccggtg
cagcccatgctggccgaggcctgcaagtccatcgagtatgcgatgaagaagtgtccgaat
ggcatgttctctgagatcaagtatgacggggaacgagtccaggtgcacaagaacggggac
cacttcagctacttcagtcgcagcctcaagcccgtcctgccgcacaaggtggcccacttt
aaggactacatcccccaggctttccctgggggccacagcatgatcttggactctgaggtg
ctcctgatcgacaacaagacaggcaaaccactgccctttgggactctgggagtgcacaag
aaagctgccttccaggatgctaatgtctgcctgtttgtttttgattgtatcttcttcaat
gatgtcagcttgatggataggcctctgtgcgagcggcggaagtttcttcatgataacatg
gttgaaattcccaaccggatcatgttctcagaaatgaagcaagtcacgaaagcttcagac
ttggccgacatgatcaatcgggtgatccaagagggtctggaagggctggtgctgaaagac
gtgaggggcacgtatgagcctggaaagcgtcattggctgaaagtgaagaaagactacttg
aacgagggggccatggctgacacagctgacctggtggtccttggggccttctatgggcaa
gggagcaaaggtggcatgatgtccatcttcctcatgggctgctatgacccgagcagccag
aagtggtgcacagtcaccaagtgtgcaggaggccacgacgacgcgacacttgcccggctg
cagaaggaactggacatggtgaagatcagcaaggatcccagcaagatacccaactggctg
aaaatcaataagatctactaccctgatttcatcgtcccagacccaaagaaagctgccgtg
tgggagatcacaggggctgaattctccaaatctgaggctcacacagccgacgggatctcc
atccgattccctcgctgcacccgaatccgtgatgataaggactggaagtctgccactaac
ctcccccaactcaaggaactgtaccagctgtccaaggagcgggcggccttcaccctagtg
gccggagatgaggggagctccaccacagggggcagcagcggagagaatgagggcacctcg
gggccagctgtctctcacaaggctccgagggcctcccccaagcggccctcggccagtgcc
aagaaggcaggagagaagctgagtggctccgacggtagaggcggcaccaagctggctgca
aagccttcccctgtgaaagtgggagagaagcggaaggcccccgatgagaccccgtgccaa
gcaaaggtgctgctggacatcttcactggggtgcggctctacctgccgccttccactcca
gacttcagtcgtctgagacgctactttgtggcattcgatggggacctggtgcaggaattt
gacatggcctcagccacacatgtgctgggtagcagggacaagaaccccgaggcccagcag
gtctccccggagtggatttgggcatgtatccggaaacggagactggtagccccctgctag

DBGET integrated database retrieval system