KEGG   Camelus dromedarius (Arabian camel): 105088374Help
Entry
105088374         CDS       T04642                                 

Gene name
UCP1
Definition
(RefSeq) mitochondrial brown fat uncoupling protein 1
  KO
K08769  solute carrier family 25 (mitochondrial uncoupling protein), member 7
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04371  Apelin signaling pathway
cdk04714  Thermogenesis
cdk05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    105088374 (UCP1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105088374 (UCP1)
  09159 Environmental adaptation
   04714 Thermogenesis
    105088374 (UCP1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    105088374 (UCP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdk02000]
    105088374 (UCP1)
Transporters [BR:cdk02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   105088374 (UCP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 105088374
NCBI-ProteinID: XP_010977610
LinkDB All DBs
Position
2
AA seq 303 aa AA seqDB search
MVGLTASDVPPTMAVKIFSAGVAACVADVITFPLDTAKVRLQIQGECQTTRAVRYKVVLG
TITTLAKTEGPGKLYSGLPAGLQRQISFASLRIGLCDTVQEFFTTGKETASSLGSKVSAG
LTTGGVAVFTGQPTEVVKVRLQAQSHLHGPKPRYTGTYNAYRIIATTEGLTGLWKGTTPN
LTRNVIINCTELVTYDLMKAALVKNKLLADDVPCHFVSAVIAGFCTTVLSSPVDVVKTRF
VNSPPSVPNCAMTMLTKEGPSAFFKGFVPSFWRLGSWNVIMFVCFEQLKRELMKSRQTVD
CAT
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggtggggctgacagcctcagacgtgcccccgaccatggcggtcaagatcttctcagcc
ggagtggcggcctgcgtggcggatgtgatcaccttcccgctggacacggccaaagtccgg
ctacagatccaaggcgaatgccagaccacccgagctgttaggtataaagttgtcctggga
acaatcaccactctggcaaaaacagaagggccagggaagctctatagcgggctgcctgct
ggcctccagagacaaataagcttcgcctctcttaggatcggcctctgtgataccgtccag
gagttcttcaccacagggaaagaaactgcctctagtttaggaagcaaggtctcagcgggc
ctcacaactggaggcgtggccgtgttcactgggcaacccacagaggtggtgaaggtcaga
ctgcaagcacagagccatctccatggtcccaaacctcgctacactggaacctacaatgct
tacagaattatagccactacagaaggcttgacggggctgtggaaagggaccactcccaat
ctgacaagaaatgttatcatcaattgtacagagctagtgacgtatgacctgatgaaggcg
gcccttgtgaaaaacaaactattagcagatgacgtgccctgccactttgtgtccgctgtt
atcgctggattttgcacaaccgttctgtcctctccagtggatgtggtgaaaaccaggttt
gttaactctccaccaagtgtgcccaactgcgcaatgacgatgctcactaaggaaggacca
tcggctttcttcaaaggatttgtaccttccttctggcgactcggatcctggaacgtcatt
atgtttgtgtgctttgaacagctgaaacgagaactgatgaagtcaaggcagaccgtggac
tgtgccacataa

DBGET integrated database retrieval system