KEGG   Camelus dromedarius (Arabian camel): 105088519
Entry
105088519         CDS       T04642                                 

Definition
(RefSeq) fatty acid-binding protein, adipocyte
  KO
K08753  fatty acid-binding protein 4, adipocyte
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    105088519
   03320 PPAR signaling pathway
    105088519
SSDB
Motif
Pfam: Lipocalin Lipocalin_7
Other DBs
NCBI-GeneID: 105088519
NCBI-ProteinID: XP_010977688
LinkDB
Position
29
AA seq 132 aa
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNVTISVNGDVINIKSESTFKN
TEISFQLGQEFDEVTADDRKVKSIVTLEGGALVQVQKWDGKSTTIKRKLVDDKLVVECIM
KDVISTRVYEKA
NT seq 399 nt   +upstreamnt  +downstreamnt
atgtgcgatgcttttgtgggcacctggaaacttgtctccagtgaaaactttgatgattac
atgaaagaagtgggagtgggctttgccaccaggaaagtggccggcatggccaaacccaac
gtgaccatcagtgtgaatggggacgtgatcaacattaaatctgaaagtacctttaaaaat
accgagatttccttccaactgggccaggaatttgatgaagtcacggcagatgacaggaaa
gtcaagagcatcgtaactttagaaggaggtgccctggtccaagtgcagaagtgggacgga
aaatcaaccaccataaagagaaaactagtggatgacaaactggtggtggaatgtatcatg
aaagatgtgatttccaccagagtttatgagaaagcataa

DBGET integrated database retrieval system