KEGG   Camelus dromedarius (Arabian camel): 105088633
Entry
105088633         CDS       T04642                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk04010  MAPK signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04020  Calcium signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04370  VEGF signaling pathway
cdk04510  Focal adhesion
cdk04926  Relaxin signaling pathway
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05211  Renal cell carcinoma
cdk05212  Pancreatic cancer
cdk05219  Bladder cancer
cdk05323  Rheumatoid arthritis
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105088633 (VEGFA)
   04014 Ras signaling pathway
    105088633 (VEGFA)
   04015 Rap1 signaling pathway
    105088633 (VEGFA)
   04370 VEGF signaling pathway
    105088633 (VEGFA)
   04066 HIF-1 signaling pathway
    105088633 (VEGFA)
   04020 Calcium signaling pathway
    105088633 (VEGFA)
   04151 PI3K-Akt signaling pathway
    105088633 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105088633 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    105088633 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105088633 (VEGFA)
   05206 MicroRNAs in cancer
    105088633 (VEGFA)
   05205 Proteoglycans in cancer
    105088633 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    105088633 (VEGFA)
   05211 Renal cell carcinoma
    105088633 (VEGFA)
   05219 Bladder cancer
    105088633 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    105088633 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105088633 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105088633 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    105088633 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105088633 (VEGFA)
   05165 Human papillomavirus infection
    105088633 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105088633 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cdk04052]
    105088633 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105088633 (VEGFA)
Cytokines and growth factors [BR:cdk04052]
 Growth factors
  Growth factors (RTK binding)
   105088633 (VEGFA)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   105088633 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 105088633
NCBI-ProteinID: XP_010977834
LinkDB
Position
20
AA seq 635 aa
MDPSHSSPLGASHSDVSRPDEGYRGTHCPDEYIVPPMPSTGLCAYEAIRVPNMPLFGRSE
MGGSGLAGSGEERRGLGQPGCEEAAARVVSGAGGSCTRSGETHRRGGRTGGVTSHGSPHW
NLIFIYPGFTLLLFPETFLKTVFFPVLIYFGFPFPAKSGRPFGEIAPVLPQITSDFGNQQ
REERGSKSSKEKSRKRDWVRERARASEKREDRGKVSDLLLGVTARARREPSPSGSRVGPA
ALTDRQTDTAPRPSAHLLPGRRPTVDAAASRGQEPEPAPGGGVEGVGARGVALKLFIQLL
GCSRSGGAVVRPGAADQSETGRSASSVREEPQSAEGEEEEEKEEERGPRWRLGSRKPGSW
TGEAAVCADSAPAARAPQALARALAPGGRGARLGAEESGRPRSPSQRGSASRASPGRASE
TMNFLLSWVHWSLALLLYLHHAKWSQAAPMTAGEQKPHEVVKFMDVYQRSYCRPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQ
DPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 1908 nt   +upstreamnt  +downstreamnt
atggaccccagtcactccagccctttgggtgcatctcactctgatgtcagcaggccagat
gagggctatagagggacacattgtccagatgaatacatcgtgccccctatgcccagcact
gggctctgtgcatatgaggccattcgagtcccaaacatgccactgtttgggaggtcagaa
atggggggatcagggttggctggtagcggtgaagagcgcagaggcttggggcagccgggc
tgcgaggaggccgcggcgcgggtggtgagtggagccggcggcagctgcactcggtccgga
gagacgcatcggcgagggggacgaaccggcggggtcacgagccacgggtctccgcactgg
aatttgatattcatttacccagggtttaccctcctcctttttcccgaaacatttttaaaa
acagtattctttcccgttttaatttattttggcttcccattccccgctaaatccggccga
ccgtttggggagattgctcctgtactcccccaaatcacttcggattttggaaatcagcag
agagaagaaagaggtagcaagagctccaaagagaagtcgaggaagagagactgggtcaga
gagcgcgcgcgggcaagcgagaaacgagaggacaggggcaaagtgagtgacctgcttttg
ggggtgaccgccagagcgcggcgtgagccctccccctcgggatcccgcgtcggaccagca
gcgctgacggacagacagacagacaccgccccccgccccagcgcccacctcctccccggc
cggcggccgacggtggacgcggccgcgagccgcgggcaggagccggagcccgcgcccgga
ggcggggtggagggggtcggggctcgcggtgttgcactgaaacttttcatccaacttctg
ggctgttctcgctccggaggagccgtggtccgccccggggcagcagatcagagcgaaacc
gggagaagtgctagctccgttcgggaggagccgcagtcggcggagggggaggaggaagaa
gagaaggaagaggagagggggccgcggtggcgactcggctctcggaagccgggctcatgg
acgggtgaggcggctgtgtgcgcagacagtgctccagccgcgcgcgcgccccaggccctg
gcccgggccttggctccgggaggaagaggagcccgcctaggcgctgaggagagcgggcgg
ccccgcagcccgagccagagagggagcgctagccgcgccagccccggccgggcctccgaa
accatgaactttctgctctcttgggtgcattggagccttgccttgctgctctacctccac
catgccaagtggtcccaggctgcacccatgacagcaggagagcagaaacctcatgaagtg
gtgaagttcatggacgtctaccagcgcagctactgccgtccaatcgagaccctggtagac
atcttccaggagtaccctgatgagatcgagtacatctttaagccgtcctgtgtgcccctg
atgaggtgcgggggctgctgcaatgatgaaggtctggagtgtgtgcccactgaggagttc
aatatcaccatgcagattatgcggattaaacctcaccaaggccaacatataggagagatg
agcttcctacagcacaacaaatgtgaatgcagaccaaagaaagacagagcaaggcaagaa
aaaaaatcagttcgaggaaagggaaaggggcaaaaaagaaagcgcaagaaatcccggtat
aaatcctggagcgttccctgtgggccttgctcagagcggagaaagcatttgtttgtacaa
gatccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcag
cttgagttaaacgaacgtacttgcagatgtgacaagccgaggcggtga

DBGET integrated database retrieval system