KEGG   Camelus dromedarius (Arabian camel): 105088684Help
Entry
105088684         CDS       T04642                                 

Definition
(RefSeq) anionic trypsin
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04080  Neuroactive ligand-receptor interaction
cdk04972  Pancreatic secretion
cdk04974  Protein digestion and absorption
cdk05164  Influenza A
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    105088684
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    105088684
   04974 Protein digestion and absorption
    105088684
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    105088684
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cdk01002]
    105088684
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105088684
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     105088684
Peptidases [BR:cdk01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   105088684
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105088684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 105088684
NCBI-ProteinID: XP_010977903
LinkDB All DBs
Position
Un
AA seq 247 aa AA seqDB search
MNPLLILAFVGAAVAVPTDDDDKIVGGYTCAENSVPYQVSLNSGYHFCGGSLISDQWVVS
AAHCYKSRIEVRLGENNIDVVEGTEQFISAAKVIRHPSYNSWTLDNDILLIKLSSPAVLS
TRVSPLALPTACAAAGTQCLISGWGNTLSSGVNYPELLQCLDAPLLSQAECEASYPGQIT
DNMVCAGFLEGGKDSCQGDSGGPVACNGELQGIVSWGYGCAQKNKPGVYTKVCNYVDWIE
ETIVANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactcctgatccttgccttcgttggagcagctgttgctgtccccactgacgac
gatgacaagatcgtcgggggctacacctgtgcggagaattccgtcccctaccaggtgtcc
ctgaactccggctaccacttctgcgggggctccctcatcagcgaccagtgggtggtgtcc
gctgctcactgctacaagtcccgcatcgaggtgaggctgggagaaaacaacatcgatgtt
gtggagggcactgagcagttcatcagtgcggccaaggtcatccggcaccccagttacaac
agctggaccctggacaatgacatcctgctgatcaaactctcgtcgcctgcagtcctcagt
acccgggtgtcccccttagctctgcccaccgcctgcgcggctgctggcacccagtgcctc
atctctggctggggcaacaccctgagctctggcgtcaactaccctgagctgctgcagtgc
ctggacgcccccctgctgagccaggccgagtgtgaggcttcgtaccccggacagatcact
gacaacatggtctgcgccggcttcctggagggaggcaaggattcctgccagggtgattct
ggtggccctgtggcctgcaatggagagctccagggtatcgtctcctggggctatggctgc
gcccagaagaacaagcctggggtctacaccaaggtctgcaactatgtagactggattgag
gagaccatcgtggccaacagctaa

DBGET integrated database retrieval system