KEGG   Camelus dromedarius (Arabian camel): 105088868
Entry
105088868         CDS       T04642                                 

Gene name
CDC42
Definition
(RefSeq) cell division control protein 42 homolog isoform X1
  KO
K04393  cell division control protein 42
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04010  MAPK signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04062  Chemokine signaling pathway
cdk04144  Endocytosis
cdk04360  Axon guidance
cdk04370  VEGF signaling pathway
cdk04510  Focal adhesion
cdk04520  Adherens junction
cdk04530  Tight junction
cdk04660  T cell receptor signaling pathway
cdk04666  Fc gamma R-mediated phagocytosis
cdk04670  Leukocyte transendothelial migration
cdk04722  Neurotrophin signaling pathway
cdk04810  Regulation of actin cytoskeleton
cdk04912  GnRH signaling pathway
cdk04932  Non-alcoholic fatty liver disease
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk05100  Bacterial invasion of epithelial cells
cdk05132  Salmonella infection
cdk05135  Yersinia infection
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05205  Proteoglycans in cancer
cdk05211  Renal cell carcinoma
cdk05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105088868 (CDC42)
   04014 Ras signaling pathway
    105088868 (CDC42)
   04015 Rap1 signaling pathway
    105088868 (CDC42)
   04370 VEGF signaling pathway
    105088868 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105088868 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105088868 (CDC42)
   04520 Adherens junction
    105088868 (CDC42)
   04530 Tight junction
    105088868 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105088868 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    105088868 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    105088868 (CDC42)
   04670 Leukocyte transendothelial migration
    105088868 (CDC42)
   04062 Chemokine signaling pathway
    105088868 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    105088868 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    105088868 (CDC42)
  09158 Development and regeneration
   04360 Axon guidance
    105088868 (CDC42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105088868 (CDC42)
   05205 Proteoglycans in cancer
    105088868 (CDC42)
   05203 Viral carcinogenesis
    105088868 (CDC42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    105088868 (CDC42)
   05211 Renal cell carcinoma
    105088868 (CDC42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    105088868 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105088868 (CDC42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105088868 (CDC42)
   05135 Yersinia infection
    105088868 (CDC42)
   05100 Bacterial invasion of epithelial cells
    105088868 (CDC42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105088868 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105088868 (CDC42)
   03036 Chromosome and associated proteins [BR:cdk03036]
    105088868 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105088868 (CDC42)
   04031 GTP-binding proteins [BR:cdk04031]
    105088868 (CDC42)
Membrane trafficking [BR:cdk04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    105088868 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    105088868 (CDC42)
  Macropinocytosis
   Ras GTPases
    105088868 (CDC42)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    105088868 (CDC42)
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   105088868 (CDC42)
  Exosomal proteins of breast milk
   105088868 (CDC42)
GTP-binding proteins [BR:cdk04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    105088868 (CDC42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 105088868
NCBI-ProteinID: XP_010978125
UniProt: A0A5N4DCX7
LinkDB
Position
13
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgcgttgttgtgggtgacggtgccgttggtaaaacatgtctcctg
atatcctacacaacaaacaaatttccatctgagtatgtaccgactgtttttgacaactat
gcagtcacagttatgattggtggagagccatatactcttggactttttgatactgcaggg
caggaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtctctccatcctcgtttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaataaacagaagcctatcactccagag
actgctgaaaagctggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactc
acacagaaaggcctaaagaatgtatttgacgaagcaatattggctgccctggaacctccg
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system