KEGG   Camelus dromedarius (Arabian camel): 105088895
Entry
105088895         CDS       T04642                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2
  KO
K09389  transcription factor E2F2
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01522  Endocrine resistance
cdk04110  Cell cycle
cdk04218  Cellular senescence
cdk04934  Cushing syndrome
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05169  Epstein-Barr virus infection
cdk05200  Pathways in cancer
cdk05206  MicroRNAs in cancer
cdk05212  Pancreatic cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05219  Bladder cancer
cdk05220  Chronic myeloid leukemia
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105088895 (E2F2)
   04218 Cellular senescence
    105088895 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105088895 (E2F2)
   05206 MicroRNAs in cancer
    105088895 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    105088895 (E2F2)
   05225 Hepatocellular carcinoma
    105088895 (E2F2)
   05226 Gastric cancer
    105088895 (E2F2)
   05214 Glioma
    105088895 (E2F2)
   05220 Chronic myeloid leukemia
    105088895 (E2F2)
   05218 Melanoma
    105088895 (E2F2)
   05219 Bladder cancer
    105088895 (E2F2)
   05215 Prostate cancer
    105088895 (E2F2)
   05224 Breast cancer
    105088895 (E2F2)
   05222 Small cell lung cancer
    105088895 (E2F2)
   05223 Non-small cell lung cancer
    105088895 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105088895 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105088895 (E2F2)
   05161 Hepatitis B
    105088895 (E2F2)
   05160 Hepatitis C
    105088895 (E2F2)
   05163 Human cytomegalovirus infection
    105088895 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105088895 (E2F2)
   05169 Epstein-Barr virus infection
    105088895 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    105088895 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105088895 (E2F2)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    105088895 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 105088895
NCBI-ProteinID: XP_010978165
LinkDB
Position
13
AA seq 468 aa
MRGRCEPPRARSPPVSAGAPGPAGELGAGLAMLRGPRALAPAAGPSPKGLPAMSPTELWS
PGLSSPQLCPATTTYYTQLYPQTVPPAAAPGTCLDATPHGPEGQAVRCVPAGRLPAKRKL
DLEGIGRPAVPEFRTPKGKSVRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESE
DGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGLFEDPTRPGKQQQ
LGRELKELMSMEQALDQLIQSCSLNFKRLTEDKANKRLAYVTYQDIRAVGNFKEQTVIAV
KAPPQTRLEVPDRNEENLQIYLKSTQGPIEVYLCPEEVQEPDSPSKEPLPSTSTLSPSPD
SAQPSSSTNLGMTEPMASSAPALTSQQVPLPPLPSLVPLEATDSMLELPHPLLQQTEDQF
LSPTLPCSSPLISFSPPLDQDDYLWGLDGGEGISDLFDSYDLGDLLIN
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgcgcgggcggtgtgagccgccgcgggctcggagcccgccggtgtcggcgggcgcgcca
ggcccggctggggagctgggggctgggctcgccatgctgcgagggccccgggccctggct
ccggccgccgggccgtcccccaaggggctgcccgcgatgagccccaccgagctgtggtcg
cctggcctcagcagcccccagctctgcccggccaccaccacctactacacccagctgtac
ccgcagactgtgcctccggctgcagcgccaggcacctgcctcgacgccaccccccacgga
cctgagggtcaagctgtgcgatgcgtgccggctggccggctgccggccaaaaggaagctg
gacctggaggggatcgggaggcctgcagtccctgaattccggacccccaaggggaagagc
gttagagtggatggcctccccagccccaaaacccccaagtcccccggggaaaagactcgc
tatgacacgtcattggggctgctcaccaagaagttcatttacctcctgagcgagtctgag
gatggggtcctggacctgaactgggctgccgaggtgctggatgtgcagaagcgccgcatc
tatgacatcaccaatgtgctggagggcatccagctcatccgcaagaaggccaagaacaac
atccagtgggtaggcaggggactatttgaagaccccactcggccggggaagcagcagcag
ctggggcgggagctgaaggagctgatgagcatggagcaggccttggaccagctcatccag
agctgttctctgaacttcaagcgcttgacggaggacaaggccaacaagagactggcctat
gtgacttaccaggacatccgtgctgtgggcaactttaaggagcagacggtgatcgctgtc
aaggcccctccgcagacaagactggaagtgcctgacaggaacgaggaaaacctgcagata
tatttgaagagcacgcaggggcctatcgaagtctacctgtgcccagaagaggtgcaggag
cctgacagtccttccaaggagcccctcccctccacctccaccctcagccccagccctgac
tctgctcagcccagcagcagcaccaaccttgggatgacagaacccatggcatcgtcagcg
ccagcactgacgtcccagcaggtcccgctgccgcccctgccatcccttgtccccctggag
gccaccgacagcatgctggagctgccacacccactcctgcagcagaccgaggaccagttc
ctgtcccccaccctaccgtgcagctcccctctgatcagcttctccccgcccttggatcag
gacgactacctgtggggcctggatggaggggagggcatcagtgacctcttcgactcatat
gaccttggggacctgctgattaactga

KEGG   Camelus dromedarius (Arabian camel): 105089193
Entry
105089193         CDS       T04642                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01522  Endocrine resistance
cdk04110  Cell cycle
cdk04218  Cellular senescence
cdk04934  Cushing syndrome
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05169  Epstein-Barr virus infection
cdk05200  Pathways in cancer
cdk05206  MicroRNAs in cancer
cdk05212  Pancreatic cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05219  Bladder cancer
cdk05220  Chronic myeloid leukemia
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105089193 (E2F3)
   04218 Cellular senescence
    105089193 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105089193 (E2F3)
   05206 MicroRNAs in cancer
    105089193 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    105089193 (E2F3)
   05225 Hepatocellular carcinoma
    105089193 (E2F3)
   05226 Gastric cancer
    105089193 (E2F3)
   05214 Glioma
    105089193 (E2F3)
   05220 Chronic myeloid leukemia
    105089193 (E2F3)
   05218 Melanoma
    105089193 (E2F3)
   05219 Bladder cancer
    105089193 (E2F3)
   05215 Prostate cancer
    105089193 (E2F3)
   05224 Breast cancer
    105089193 (E2F3)
   05222 Small cell lung cancer
    105089193 (E2F3)
   05223 Non-small cell lung cancer
    105089193 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105089193 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105089193 (E2F3)
   05161 Hepatitis B
    105089193 (E2F3)
   05160 Hepatitis C
    105089193 (E2F3)
   05163 Human cytomegalovirus infection
    105089193 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105089193 (E2F3)
   05169 Epstein-Barr virus infection
    105089193 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    105089193 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105089193 (E2F3)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    105089193 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 105089193
NCBI-ProteinID: XP_031290994
LinkDB
Position
20
AA seq 340 aa
MPLQQQAKRRLELGESGQQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGL
LTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCS
LSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIR
KISGLKDQTVIVVKAPPETRLEVPDPIESLQIHLASTQGPIEVYLCPEETETHSPMKTNN
QDHNGNIPKPTSKDLASTNSGHSDCSISMANLSPLASPANLLQQTEDQIPSNLEGPFVNL
LPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcccttacagcagcaggcaaagcgcaggctggagctaggagaaagcggtcagcagtac
ctctcagatggtttaaaaacccccaagggcaaaggcagagctgcgctccgaagtccagat
agtccaaaaactccaaaatctccctcagaaaaaacacggtatgatacgtcacttggtctg
ctcaccaagaagttcattcagctactgagccagtcaccggatggggtcttggatttgaac
aaggcggcagaggtgctgaaggtgcaaaagagaaggatttatgacatcaccaatgtcctg
gaaggcatccacctcattaagaagaagtctaagaacaacgtgcagtggatgggctgcagt
ctgtctgaggacgggggcatgctggcccagtgtcaaggcctgtcaaaagaagtgaccgag
ctcagtcaggaagagaagaaattagatgaactgatccaaagctgcaccctggacctcaaa
ctgttaaccgaggattcagagaatcaaaggttagcttatgttacatatcaagatattcga
aaaattagtggccttaaagaccaaactgttatagttgtgaaagcccctccagaaacaaga
cttgaagtgcctgacccaatagagagcctgcaaatacatttggcaagtacccaaggaccc
attgaggtttatttgtgtccagaagagactgaaacacacagtccgatgaaaacaaacaac
caagaccacaatgggaatatccctaaacccacttccaaagacttggcttcaaccaactca
ggacatagtgattgctcgatctctatggcaaacctttctcctctggcctccccagccaac
cttttacagcagactgaggaccaaattccttccaacctagaaggaccatttgtgaactta
ctgcctcccctgctccaagaagactatctgctaagccttggggaggaagaaggcatcagt
gatctctttgacgcttatgatttggaaaagctcccgctggtggaagactttatgtgtagt
tga

KEGG   Camelus dromedarius (Arabian camel): 105092697
Entry
105092697         CDS       T04642                                 

Gene name
E2F1
Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01522  Endocrine resistance
cdk04110  Cell cycle
cdk04137  Mitophagy - animal
cdk04218  Cellular senescence
cdk04934  Cushing syndrome
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05169  Epstein-Barr virus infection
cdk05200  Pathways in cancer
cdk05206  MicroRNAs in cancer
cdk05212  Pancreatic cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05219  Bladder cancer
cdk05220  Chronic myeloid leukemia
cdk05222  Small cell lung cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    105092697 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    105092697 (E2F1)
   04218 Cellular senescence
    105092697 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105092697 (E2F1)
   05206 MicroRNAs in cancer
    105092697 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    105092697 (E2F1)
   05225 Hepatocellular carcinoma
    105092697 (E2F1)
   05226 Gastric cancer
    105092697 (E2F1)
   05214 Glioma
    105092697 (E2F1)
   05220 Chronic myeloid leukemia
    105092697 (E2F1)
   05218 Melanoma
    105092697 (E2F1)
   05219 Bladder cancer
    105092697 (E2F1)
   05215 Prostate cancer
    105092697 (E2F1)
   05224 Breast cancer
    105092697 (E2F1)
   05222 Small cell lung cancer
    105092697 (E2F1)
   05223 Non-small cell lung cancer
    105092697 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105092697 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105092697 (E2F1)
   05161 Hepatitis B
    105092697 (E2F1)
   05160 Hepatitis C
    105092697 (E2F1)
   05163 Human cytomegalovirus infection
    105092697 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105092697 (E2F1)
   05169 Epstein-Barr virus infection
    105092697 (E2F1)
   05165 Human papillomavirus infection
    105092697 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    105092697 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105092697 (E2F1)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    105092697 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 105092697
NCBI-ProteinID: XP_031289832
LinkDB
Position
19
AA seq 498 aa
MVVAVGGSWLFRGKKDLARKSGRDFAGSRGRGGAGPGAGSSPRAACRRAAPPPPPATRAR
GRERHGVAGAPLAAMRAGAEALLGPARAGLLDSSIVSXSTAQDASAPPAPAGPAAPTAGP
XDPDLLLFARAGPRPTPSAQRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGV
KSPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQL
IAKKSKNHIQWLGSHAAVGIGGRLEGLTQDLRQLQESERQLDHLIHICTTQLRLLSEDAD
SQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCP
EESAGGISPGKTPSQGAASGEEDRAADPATTVPPPPSSPPSSPATDPSQSLLSLEHEPLL
SRMGGLRAPADEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGE
GIRDLFDCDFGDLTPLDF
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggtggtagcggtcggcggctcgtggctctttcgcggcaaaaaggatttggcgcgtaaa
agtggccgggactttgcaggcagccgcggccggggcggagcgggacccggagcgggatcg
agccctcgcgcggcctgccggagggccgcgccgccgccgccgcctgccacccgggcgcgc
gggcgtgagcgccatggcgtggcaggggccccgctggcggccatgcgcgccggcgcggag
gccctgctcgggccggcgcgtgcggggctgctcgactcctcgatcgtatcannttccacg
gcgcaggacgccagcgccccgccggcccccgccggcccggccgcgcccacagccggcccc
ngcgaccccgacctgctgctcttcgcacgcgcagggccccggcccacacccagcgcgcag
cgcccggcgctcggccgcccgccggtgaagcggaggctggacctggaaactgaccatcag
tacctggctgagagcagcgggccagctcggggcagaggccgccacccaggaaaaggtgtg
aaatcgccaggggagaagtcacgctatgagacatcgctgaatctgaccaccaaacgcttc
ctggagttgctgagccgctcggctgatggtgttgtcgacctgaactgggcagcggaggtg
ctgaaagtgcagaaacggcgcatctacgacatcaccaacgtcctcgagggcatccagctc
attgccaagaagtccaagaatcacatccagtggctaggcagccacgcagcagtggggatt
ggtgggcggcttgaaggactgacccaggacctccggcaactgcaggagagcgagcggcag
ctggaccacctgatccatatctgcaccacacagctgcgtctgctttccgaggatgctgac
agccagcgcctggcctacgtgacctgccaggaccttcgtagcatcgccgaccctgcagag
cagatggtcatggtgatcaaggcccctcccgagacccagcttcaagccgtggactcctca
gagacctttcagatctcccttaagagcaaacaaggccccatcgacgttttcctgtgccct
gaggagagtgcgggcgggatcagccctgggaagaccccgtcccagggggcagcttccggg
gaggaggacagggcagctgaccctgccaccacagtgccaccaccaccatcatctcccccc
tcatcccctgccacggatcccagtcagtccctactcagcctggagcacgaacctctgctt
tcccggatgggtggcctgcgggcccccgcggacgaggaccgcctgtccccgctggtggcg
gccgattcgctcctggagcatgtgcgggaggacttctccggcctcctccctgaggagttc
atcagcctatcccccccccatgaggccctcgactaccactttggccttgaagagggcgag
ggcatcagagacctcttcgactgtgactttggggaccttactcccctggatttctga

DBGET integrated database retrieval system