KEGG   Camelus dromedarius (Arabian camel): 105088937
Entry
105088937         CDS       T04642                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk04010  MAPK signaling pathway
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04915  Estrogen signaling pathway
cdk05200  Pathways in cancer
cdk05210  Colorectal cancer
cdk05211  Renal cell carcinoma
cdk05212  Pancreatic cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05223  Non-small cell lung cancer
cdk05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105088937 (TGFA)
   04012 ErbB signaling pathway
    105088937 (TGFA)
   04014 Ras signaling pathway
    105088937 (TGFA)
   04151 PI3K-Akt signaling pathway
    105088937 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    105088937 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105088937 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105088937 (TGFA)
   05212 Pancreatic cancer
    105088937 (TGFA)
   05225 Hepatocellular carcinoma
    105088937 (TGFA)
   05214 Glioma
    105088937 (TGFA)
   05211 Renal cell carcinoma
    105088937 (TGFA)
   05215 Prostate cancer
    105088937 (TGFA)
   05223 Non-small cell lung cancer
    105088937 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105088937 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 105088937
NCBI-ProteinID: XP_031323085
LinkDB
Position
15
AA seq 159 aa
MVTSAGQLALFALGVLLAVCQALENSTSALSDPPVAAAVVSHFNDCPDSHSQFCFHGTCR
FLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtcacctccgctggacagctcgccctcttcgcgctgggtgttttgttggctgtgtgc
caggccctggagaacagcacgtctgccctgagtgacccgccggtggctgcagctgtggtg
tcccattttaatgactgcccagattcccacagtcagttctgcttccatggaacctgcagg
tttttggtgcaggaggacaagccagcatgtgtctgccattctgggtacgtcggtgcgcgc
tgtgaacacgcagacctcctggccgtggtggctgccagccagaagaagcaggccattacc
gccttggtggtggtctccatcgtggccctggctgtcctcatcatcacttgtgtgctgata
cactgctgccaagtccgaaaacactgtgagtggtgccgggccctcatctgccggcacgag
aagcccagtgccctcctgaagggaaggactgcttgctgccactcagaaacagtggtctga

DBGET integrated database retrieval system