KEGG   Camelus dromedarius (Arabian camel): 105088999
Entry
105088999         CDS       T04642                                 

Gene name
BCL2
Definition
(RefSeq) LOW QUALITY PROTEIN: apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk01524  Platinum drug resistance
cdk04064  NF-kappa B signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04071  Sphingolipid signaling pathway
cdk04115  p53 signaling pathway
cdk04140  Autophagy - animal
cdk04141  Protein processing in endoplasmic reticulum
cdk04151  PI3K-Akt signaling pathway
cdk04210  Apoptosis
cdk04215  Apoptosis - multiple species
cdk04217  Necroptosis
cdk04261  Adrenergic signaling in cardiomyocytes
cdk04340  Hedgehog signaling pathway
cdk04510  Focal adhesion
cdk04621  NOD-like receptor signaling pathway
cdk04630  JAK-STAT signaling pathway
cdk04722  Neurotrophin signaling pathway
cdk04725  Cholinergic synapse
cdk04915  Estrogen signaling pathway
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk05014  Amyotrophic lateral sclerosis
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05132  Salmonella infection
cdk05145  Toxoplasmosis
cdk05152  Tuberculosis
cdk05161  Hepatitis B
cdk05162  Measles
cdk05168  Herpes simplex virus 1 infection
cdk05169  Epstein-Barr virus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05200  Pathways in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05215  Prostate cancer
cdk05222  Small cell lung cancer
cdk05226  Gastric cancer
cdk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105088999 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105088999 (BCL2)
   04630 JAK-STAT signaling pathway
    105088999 (BCL2)
   04064 NF-kappa B signaling pathway
    105088999 (BCL2)
   04066 HIF-1 signaling pathway
    105088999 (BCL2)
   04071 Sphingolipid signaling pathway
    105088999 (BCL2)
   04151 PI3K-Akt signaling pathway
    105088999 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105088999 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    105088999 (BCL2)
   04215 Apoptosis - multiple species
    105088999 (BCL2)
   04217 Necroptosis
    105088999 (BCL2)
   04115 p53 signaling pathway
    105088999 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105088999 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    105088999 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    105088999 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    105088999 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105088999 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    105088999 (BCL2)
   04722 Neurotrophin signaling pathway
    105088999 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105088999 (BCL2)
   05206 MicroRNAs in cancer
    105088999 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105088999 (BCL2)
   05226 Gastric cancer
    105088999 (BCL2)
   05215 Prostate cancer
    105088999 (BCL2)
   05222 Small cell lung cancer
    105088999 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    105088999 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    105088999 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    105088999 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105088999 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105088999 (BCL2)
   05152 Tuberculosis
    105088999 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    105088999 (BCL2)
   05161 Hepatitis B
    105088999 (BCL2)
   05162 Measles
    105088999 (BCL2)
   05168 Herpes simplex virus 1 infection
    105088999 (BCL2)
   05169 Epstein-Barr virus infection
    105088999 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105088999 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105088999 (BCL2)
   01524 Platinum drug resistance
    105088999 (BCL2)
   01522 Endocrine resistance
    105088999 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cdk01009]
    105088999 (BCL2)
Protein phosphatases and associated proteins [BR:cdk01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105088999 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 105088999
NCBI-ProteinID: XP_010978295
LinkDB
Position
30
AA seq 237 aa
MAHPGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAVFPGAAPAPGIFSSQPGRTPAPT
RTSPPRPRPAPXAAAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLT
PFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLN
RHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
NT seq 714 nt   +upstreamnt  +downstreamnt
atggcgcaccctgggagaacagggtacgataaccgggagatagtgatgaaatacatccac
tataagctgtcgcagaggggctacgagtgggatgccggagacgcgggtgccgtgttcccg
ggggccgcccccgcgccgggcatcttctcctcccaacccgggcgcacccccgcgcccacc
aggacctcgccgccccgcccccgacccgcccctnccgccgccgccgccgccgccgccgca
gggcctgcgctcagccctgtgccacctgtggtccacctgaccctgcgccaggccggcgat
gacttctcccgtcgctaccgccgcgactttgccgagatgtccagccagctccacctgacg
cccttcaccgcgaggggacgctttgccacggtggtggaggagctcttcagggatggggtg
aactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtc
aaccgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtacctgaat
cggcacctgcacacctggatccaggataacggaggctgggacgcctttgtggagctgtat
ggccccagcatgcggcctctgtttgatttctcctggctgtctctgaaggcgctgctcagt
ctggccctagtgggagcttgcatcaccctgggtgcctatctgggccataagtga

DBGET integrated database retrieval system