KEGG   Camelus dromedarius (Arabian camel): 105089327Help
Entry
105089327         CDS       T04642                                 

Gene name
CREB3L4
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04022  cGMP-PKG signaling pathway
cdk04024  cAMP signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04211  Longevity regulating pathway
cdk04261  Adrenergic signaling in cardiomyocytes
cdk04668  TNF signaling pathway
cdk04714  Thermogenesis
cdk04725  Cholinergic synapse
cdk04728  Dopaminergic synapse
cdk04911  Insulin secretion
cdk04915  Estrogen signaling pathway
cdk04916  Melanogenesis
cdk04918  Thyroid hormone synthesis
cdk04922  Glucagon signaling pathway
cdk04925  Aldosterone synthesis and secretion
cdk04926  Relaxin signaling pathway
cdk04927  Cortisol synthesis and secretion
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04931  Insulin resistance
cdk04934  Cushing syndrome
cdk04935  Growth hormone synthesis, secretion and action
cdk04962  Vasopressin-regulated water reabsorption
cdk05016  Huntington disease
cdk05030  Cocaine addiction
cdk05031  Amphetamine addiction
cdk05034  Alcoholism
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05203  Viral carcinogenesis
cdk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    105089327 (CREB3L4)
   04024 cAMP signaling pathway
    105089327 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    105089327 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    105089327 (CREB3L4)
   04152 AMPK signaling pathway
    105089327 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    105089327 (CREB3L4)
   04922 Glucagon signaling pathway
    105089327 (CREB3L4)
   04915 Estrogen signaling pathway
    105089327 (CREB3L4)
   04926 Relaxin signaling pathway
    105089327 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    105089327 (CREB3L4)
   04918 Thyroid hormone synthesis
    105089327 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    105089327 (CREB3L4)
   04916 Melanogenesis
    105089327 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    105089327 (CREB3L4)
   04927 Cortisol synthesis and secretion
    105089327 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105089327 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    105089327 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    105089327 (CREB3L4)
   04728 Dopaminergic synapse
    105089327 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    105089327 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    105089327 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    105089327 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    105089327 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    105089327 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    105089327 (CREB3L4)
   05031 Amphetamine addiction
    105089327 (CREB3L4)
   05034 Alcoholism
    105089327 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105089327 (CREB3L4)
   04934 Cushing syndrome
    105089327 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105089327 (CREB3L4)
   05161 Hepatitis B
    105089327 (CREB3L4)
   05163 Human cytomegalovirus infection
    105089327 (CREB3L4)
   05165 Human papillomavirus infection
    105089327 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105089327 (CREB3L4)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    105089327 (CREB3L4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB KASH_CCD HAUS-augmin3
Motif
Other DBs
NCBI-GeneID: 105089327
NCBI-ProteinID: XP_010978671
LinkDB All DBs
Position
21
AA seq 436 aa AA seqDB search
MDFRTPDLLDVWLEPPEDVFSTGSFLELGLSLPPEGPVTRLQEQGLQGWESSGGHGCGLQ
ESESEDFLKLFIDPNEVYCSEASPGSDSGISEDPGHPDSPPALKPPSSPALYEVVYETGA
LERMQEEAGTAVGFISIQLDQWSPPFMVPDACVVSELPADTHAHILPRAGTVNPVPPAAL
LPCPTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEY
IDGLESRVAACSAQNQELQKKVHELERHNISLVTQLRQLQMLIVQTSNKAAQTSTCVLIL
LFSLALIILPSFSPFQGLPEAGPEDYQPHGGERQRQEGILFSRVVKRWEGDPVLSRIPQP
RDHYTTALFLHPTVISRNILTHKDMTENLENPVVESRLEGPPGAKGANGSTQTLLEKERR
AGPNRHIRTVLHADEM
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggatttcagaacccctgacctgctggatgtgtggctggagcccccagaagatgtcttc
tcaacaggatccttcctggagctgggactctctctacctccagagggcccagtaactagg
ctgcaagaacaggggctgcaaggctgggagtccagtgggggccatggctgtggtcttcaa
gagagtgagtctgaagatttcctgaagcttttcattgatcccaatgaagtgtactgctca
gaagcatctcctggcagtgacagtggaatctctgaggatcctggccatccagacagtccc
cctgccctgaagccacccagttcccctgccctctatgaggttgtctatgagacaggagcc
ctggagaggatgcaggaggaagctgggacagctgtagggttcatttccatccaactagat
caatggagcccaccatttatggtgcctgatgcctgcgtggtcagtgagctacctgctgac
actcatgcgcacatcctgcccagagcgggcactgtaaacccagtgcctcctgcagccctg
ctgccctgtccaaccttgttcctgacagatgaggagaagcgtctgctgggacaggaaggg
gtttccctaccctctcacctgcccctcactaaggcagaggagagggtcctcaagaaggtc
aggaggaaaattcgtaacaagcagtcagctcaggacagtcggcgacggaagaaagagtac
atcgatggactggagagcagggtggctgcctgttctgcacagaaccaggaactacagaag
aaagtccacgagctggagagacacaacatctccctggtgactcagctccgccagctgcag
atgcttattgttcaaacttccaacaaagctgcccagactagcacttgtgttctgatcctt
cttttctccttggctctcatcatcctgcccagtttcagcccctttcagggcctaccagaa
gctgggcctgaggattaccagcctcatggaggtgagaggcaaaggcaggaagggattctg
ttttccagggtagtcaagaggtgggagggagatcctgttctgtctaggatcccccaacca
agggaccactatactactgcccttttccttcaccccacagtgatttccagaaacatcctg
actcacaaggacatgacagaaaatctggagaaccctgtggtagagtctagattggagggg
ccacctggggccaagggtgcaaatggctcaacacagacactgcttgagaaggaaaggagg
gcagggcccaacagacacatcagaactgtgctgcacgcagatgagatgtga

KEGG   Camelus dromedarius (Arabian camel): 105091622Help
Entry
105091622         CDS       T04642                                 

Gene name
CREB3L2
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04022  cGMP-PKG signaling pathway
cdk04024  cAMP signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04211  Longevity regulating pathway
cdk04261  Adrenergic signaling in cardiomyocytes
cdk04668  TNF signaling pathway
cdk04714  Thermogenesis
cdk04725  Cholinergic synapse
cdk04728  Dopaminergic synapse
cdk04911  Insulin secretion
cdk04915  Estrogen signaling pathway
cdk04916  Melanogenesis
cdk04918  Thyroid hormone synthesis
cdk04922  Glucagon signaling pathway
cdk04925  Aldosterone synthesis and secretion
cdk04926  Relaxin signaling pathway
cdk04927  Cortisol synthesis and secretion
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04931  Insulin resistance
cdk04934  Cushing syndrome
cdk04935  Growth hormone synthesis, secretion and action
cdk04962  Vasopressin-regulated water reabsorption
cdk05016  Huntington disease
cdk05030  Cocaine addiction
cdk05031  Amphetamine addiction
cdk05034  Alcoholism
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05203  Viral carcinogenesis
cdk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    105091622 (CREB3L2)
   04024 cAMP signaling pathway
    105091622 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    105091622 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    105091622 (CREB3L2)
   04152 AMPK signaling pathway
    105091622 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    105091622 (CREB3L2)
   04922 Glucagon signaling pathway
    105091622 (CREB3L2)
   04915 Estrogen signaling pathway
    105091622 (CREB3L2)
   04926 Relaxin signaling pathway
    105091622 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    105091622 (CREB3L2)
   04918 Thyroid hormone synthesis
    105091622 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    105091622 (CREB3L2)
   04916 Melanogenesis
    105091622 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    105091622 (CREB3L2)
   04927 Cortisol synthesis and secretion
    105091622 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105091622 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    105091622 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    105091622 (CREB3L2)
   04728 Dopaminergic synapse
    105091622 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    105091622 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    105091622 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    105091622 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    105091622 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    105091622 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    105091622 (CREB3L2)
   05031 Amphetamine addiction
    105091622 (CREB3L2)
   05034 Alcoholism
    105091622 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105091622 (CREB3L2)
   04934 Cushing syndrome
    105091622 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105091622 (CREB3L2)
   05161 Hepatitis B
    105091622 (CREB3L2)
   05163 Human cytomegalovirus infection
    105091622 (CREB3L2)
   05165 Human papillomavirus infection
    105091622 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105091622 (CREB3L2)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    105091622 (CREB3L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf JMY HAUS-augmin3
Motif
Other DBs
NCBI-GeneID: 105091622
NCBI-ProteinID: XP_010981468
LinkDB All DBs
Position
7
AA seq 520 aa AA seqDB search
MEVLESGEQSVLQWDRKLSELSEPGETEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFTHITTNDSFNDDEVESEKWYLSTDF
PSTTIKTEPITDEPPSGLVPSVTLTITAISTPFEKEEPPLEMNTGVDSSCQTVIPKIKLE
PHEVDQFLNFSPKEGSVDHLHLPPTPPSSHSSDSEGSLSPSPRLHPFGLPQTHSPARAPA
RATSALASSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGCGPYPSATKMALPSQQSLQEPYT
ASVVRSRNLLIYEEHSPLEEPSSPASAGELGRWDGGSSLLRASGLESLPDVDLPHFIISN
ESSLEKSVLLELQQHLVSTKLEGNETLKVVELDRRVNATF
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagcgtcctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggggaaaccgaggctctcatgtatcacacgcacttctcagagcttctg
gatgagttttcccagaacgtcttgggtcagcttctgaacgaccctttcctctcggagaag
agtgtgtccatggaggtggagccctccccaacatccccagcgcctctcatccaggctgag
cacagctactctctgtgtgaggagcctcgggcccagtcgccattcacccacattaccacc
aatgacagcttcaatgacgatgaagtggagagtgagaaatggtacctgtctacagacttt
ccatcaacaaccatcaagacagagccgattacagatgagccgccctcgggacttgttcct
tctgtcactctgaccatcacagccatctccaccccttttgaaaaggaggaaccccctctg
gaaatgaacactggggttgattcctcgtgccagacagttattcctaagattaagctggag
cctcatgaagtggatcagttcctaaacttctctcctaaagaaggctccgtggaccacctg
cacttaccgcccacccctcccagcagccacagcagcgactcggagggcagcctgagcccc
agcccacgcctgcaccccttcggcctgccgcagacccacagccctgccagggccccggcg
cgggccacctcagcgctcgccagctccccgctcctcaccgcaccccacaagctgcaggga
tcaggccccctggtcctgacagaggaggagaagaggaccctgattgctgagggttatccc
atccccaccaagttgcccctgacaaaatcggaggagaaggccctaaagaaaatccggagg
aaaatcaagaataagatttctgctcaagaaagtaggagaaagaagaaagaatacatggac
agcctggagaaaaaggtggagtcttgttcaactgagaacctggagcttcggaagaaggtg
gaggttctggagaacaccaacagaactctcctgcagcaactgcagaagcttcagactttg
gtgatgggcaaggtttctcgcacctgcaagctggccggcacgcagactggcacctgcctc
atggtcgttgtgttatgctttgccgtagcatttggcagcttctttcaaggctgtgggccc
tacccttctgccaccaagatggccctgcccagccagcagtccctgcaggagccctacacg
gcctctgtcgtgagatccaggaacctgctgatctatgaggaacattctcccctggaagag
ccgtccagtccggcctcagccggggagcttgggcgctgggacggaggctcctccctgctc
agggcctcggggctggagtccctgcctgacgtggatcttccccatttcattatctcaaat
gagagcagcctggagaagtcagtgctgttggagctgcagcagcacctggtcagcaccaag
ctggaggggaatgaaacactgaaagttgtagaactcgacagaagagtgaacgccaccttc
taa

KEGG   Camelus dromedarius (Arabian camel): 105093562Help
Entry
105093562         CDS       T04642                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X2
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04022  cGMP-PKG signaling pathway
cdk04024  cAMP signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04211  Longevity regulating pathway
cdk04261  Adrenergic signaling in cardiomyocytes
cdk04380  Osteoclast differentiation
cdk04612  Antigen processing and presentation
cdk04668  TNF signaling pathway
cdk04710  Circadian rhythm
cdk04713  Circadian entrainment
cdk04714  Thermogenesis
cdk04725  Cholinergic synapse
cdk04728  Dopaminergic synapse
cdk04911  Insulin secretion
cdk04915  Estrogen signaling pathway
cdk04916  Melanogenesis
cdk04918  Thyroid hormone synthesis
cdk04922  Glucagon signaling pathway
cdk04924  Renin secretion
cdk04925  Aldosterone synthesis and secretion
cdk04926  Relaxin signaling pathway
cdk04927  Cortisol synthesis and secretion
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04931  Insulin resistance
cdk04934  Cushing syndrome
cdk04935  Growth hormone synthesis, secretion and action
cdk04962  Vasopressin-regulated water reabsorption
cdk05016  Huntington disease
cdk05030  Cocaine addiction
cdk05031  Amphetamine addiction
cdk05034  Alcoholism
cdk05152  Tuberculosis
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05203  Viral carcinogenesis
cdk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    105093562 (CREB1)
   04024 cAMP signaling pathway
    105093562 (CREB1)
   04022 cGMP-PKG signaling pathway
    105093562 (CREB1)
   04151 PI3K-Akt signaling pathway
    105093562 (CREB1)
   04152 AMPK signaling pathway
    105093562 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    105093562 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    105093562 (CREB1)
   04922 Glucagon signaling pathway
    105093562 (CREB1)
   04915 Estrogen signaling pathway
    105093562 (CREB1)
   04926 Relaxin signaling pathway
    105093562 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    105093562 (CREB1)
   04918 Thyroid hormone synthesis
    105093562 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    105093562 (CREB1)
   04916 Melanogenesis
    105093562 (CREB1)
   04924 Renin secretion
    105093562 (CREB1)
   04925 Aldosterone synthesis and secretion
    105093562 (CREB1)
   04927 Cortisol synthesis and secretion
    105093562 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105093562 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    105093562 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    105093562 (CREB1)
   04728 Dopaminergic synapse
    105093562 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    105093562 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    105093562 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    105093562 (CREB1)
   04713 Circadian entrainment
    105093562 (CREB1)
   04714 Thermogenesis
    105093562 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    105093562 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    105093562 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    105093562 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    105093562 (CREB1)
   05031 Amphetamine addiction
    105093562 (CREB1)
   05034 Alcoholism
    105093562 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105093562 (CREB1)
   04934 Cushing syndrome
    105093562 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    105093562 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105093562 (CREB1)
   05161 Hepatitis B
    105093562 (CREB1)
   05163 Human cytomegalovirus infection
    105093562 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105093562 (CREB1)
   05165 Human papillomavirus infection
    105093562 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105093562 (CREB1)
   03029 Mitochondrial biogenesis [BR:cdk03029]
    105093562 (CREB1)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    105093562 (CREB1)
Mitochondrial biogenesis [BR:cdk03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    105093562 (CREB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf DUF4988 Rh5
Motif
Other DBs
NCBI-GeneID: 105093562
NCBI-ProteinID: XP_010983747
LinkDB All DBs
Position
5
AA seq 327 aa AA seqDB search
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccagcaaatgacagtgcaagcccagccacagattgccacattagcccaggtatcc
atgccagcagctcacgcaacatcatctgctcccaccgtaactttagtacagctgcccaat
gggcagacagttcaagtccatggagttattcaggcggcccagccatcagttattcagtct
ccacaagtccagacagttcagatttcaactattgcagaaagtgaagattcacaggagtca
gtagatagtgtaactgattcccaaaaacgaagagaaattctttcaaggaggccttcctac
aggaaaattttgaatgacttatcttctgatgcaccaggagtgccaaggattgaagaagag
aagtcggaagaggagacttcagcacctgccatcaccactgtaacggtgccaactccaatt
taccaaactagcagtggacagtatattgccattacccagggaggagcaatacagctggct
aacaatggtaccgatggggtacagggcctgcaaacgttaaccatgaccaatgcagctgcc
acacagccgggtactaccattctacagtatgcacagaccactgatggacagcagatctta
gtgcccagcaaccaagttgttgttcaagctgcctctggagatgtacaaacataccagatt
cgcacagcgcccactagcaccattgcccctggagttgttatggcgtcctccccagcactt
cctacgcagccggccgaagaagcagcacgaaagagagaggttcgcctaatgaagaacagg
gaagcagcacgagaatgtcgtagaaagaagaaagaatatgtgaaatgtttagaaaacaga
gtggcagtgcttgaaaaccaaaacaagacattgattgaggagctaaaagcacttaaggac
ctttactgccacaaatcagattaa

KEGG   Camelus dromedarius (Arabian camel): 105095833Help
Entry
105095833         CDS       T04642                                 

Gene name
CREB5
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5 isoform X1
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04022  cGMP-PKG signaling pathway
cdk04024  cAMP signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04211  Longevity regulating pathway
cdk04261  Adrenergic signaling in cardiomyocytes
cdk04668  TNF signaling pathway
cdk04714  Thermogenesis
cdk04725  Cholinergic synapse
cdk04728  Dopaminergic synapse
cdk04911  Insulin secretion
cdk04915  Estrogen signaling pathway
cdk04918  Thyroid hormone synthesis
cdk04922  Glucagon signaling pathway
cdk04925  Aldosterone synthesis and secretion
cdk04926  Relaxin signaling pathway
cdk04927  Cortisol synthesis and secretion
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04931  Insulin resistance
cdk04934  Cushing syndrome
cdk04935  Growth hormone synthesis, secretion and action
cdk04962  Vasopressin-regulated water reabsorption
cdk05016  Huntington disease
cdk05030  Cocaine addiction
cdk05031  Amphetamine addiction
cdk05034  Alcoholism
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05203  Viral carcinogenesis
cdk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    105095833 (CREB5)
   04024 cAMP signaling pathway
    105095833 (CREB5)
   04022 cGMP-PKG signaling pathway
    105095833 (CREB5)
   04151 PI3K-Akt signaling pathway
    105095833 (CREB5)
   04152 AMPK signaling pathway
    105095833 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    105095833 (CREB5)
   04922 Glucagon signaling pathway
    105095833 (CREB5)
   04915 Estrogen signaling pathway
    105095833 (CREB5)
   04926 Relaxin signaling pathway
    105095833 (CREB5)
   04935 Growth hormone synthesis, secretion and action
    105095833 (CREB5)
   04918 Thyroid hormone synthesis
    105095833 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    105095833 (CREB5)
   04925 Aldosterone synthesis and secretion
    105095833 (CREB5)
   04927 Cortisol synthesis and secretion
    105095833 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105095833 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    105095833 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    105095833 (CREB5)
   04728 Dopaminergic synapse
    105095833 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    105095833 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    105095833 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    105095833 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    105095833 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    105095833 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    105095833 (CREB5)
   05031 Amphetamine addiction
    105095833 (CREB5)
   05034 Alcoholism
    105095833 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105095833 (CREB5)
   04934 Cushing syndrome
    105095833 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105095833 (CREB5)
   05161 Hepatitis B
    105095833 (CREB5)
   05163 Human cytomegalovirus infection
    105095833 (CREB5)
   05165 Human papillomavirus infection
    105095833 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105095833 (CREB5)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    105095833 (CREB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB NDUFB11 TolA_bind_tri GIT_CC
Motif
Other DBs
NCBI-GeneID: 105095833
NCBI-ProteinID: XP_031310965
LinkDB All DBs
Position
7
AA seq 598 aa AA seqDB search
MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTP
TPTRFLKNCEEVGLFNELDCSLEHEFRKAQEEESSKRNISMHNTVGGAMAGPGAHQLGST
RMPNHDTSVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMP
GTLPNPTMPGSSAVLMPMERQMSVNSNLLGMQGPNLSNPCASPQVQPMHSEAKMACPRLS
IFSATSSQQTETAHASLHAWDPTQPYNAGILCCPDANGETNVSELQPPGNARSKSQQPLC
FSPSPANAFRSQNVSPGTYDCPTLRLKAALTHHPAAMSNGNMNTMGHMMEMMGSRQDQTP
HHHMHSHPHQHQTLPAHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTS
PHPPLHSGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERNRAAAT
RCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQLLLTHKDCPITAMQKES
QGYLSPESSPPASPVPTCSQQQVIQHNTITTSSAVSEVVGSSTLSQLTTHRTDLNPIL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgatttatgaggaatccaagatgaatttggagcaggagaggccgtttgtctgcagcgcc
ccaggctgctcccagcgcttcccaacagaggaccatctgatgattcataggcacaagcat
gaaatgactttgaagtttccctcaataaaaacagacaatatgttatcagatcagactccg
accccaacaagattcctgaagaactgcgaggaagtggggctcttcaatgagctggactgc
tccctcgagcatgagttcaggaaggctcaggaggaggagagcagcaagcggaatatctcg
atgcataacaccgttggtggggccatggcggggcctggagctcaccagcttggcagcacc
cggatgcccaaccacgacaccagcgtcgtgattcagcaagccatgccatcaccccagtcc
agctctgtcatcacgcaggcaccttccaccaaccgccagatcgggcctgtcccaggctct
ctatcttctctgctacatcttcacaacagacagagacagcccatgccagcctccatgcct
gggaccctacccaaccctacaatgccgggatcctctgctgtcctgatgccaatggagaga
caaatgtcagtgaactccaacctcctgggaatgcaaggtccaaatctcagcaacccctgt
gcttctccccaagtccagccaatgcattcagaagccaaaatggcctgtcccaggctctct
atcttctctgctacatcttcacaacagacagagacagcccatgccagcctccatgcctgg
gaccctacccaaccctacaatgccgggatcctctgctgtcctgatgccaatggagagaca
aatgtcagtgaactccaacctcctgggaatgcaaggtccaaatctcagcaacccctgtgc
ttctccccaagtccagccaatgcattcagaagccaaaatgtgtcccctggcacgtacgac
tgtccgactttgaggttgaaggctgcgctgactcaccaccctgctgccatgtcaaatggg
aatatgaacaccatgggacacatgatggaaatgatgggctcccggcaagaccagacgcca
catcatcacatgcactcacacccgcatcagcaccagacactgccagcccatcacccctac
ccacaccagcaccagcacccagcacaccatcctcatcctcaaccccatcaccagcagaac
cacccgcatcatcactcccactcccaccttcatgcacacccagcacatcaccagacctcg
ccacacccacccctgcactccggcaaccaagcacaggtttcaccagcgacacaacagatg
cagccaacccagacaatacagccgccccagcccacaggggggcgccggcgcagggtggtg
gacgaggatcccgacgagaggcggcggaaatttctggaacggaaccgggcggccgccacc
cgctgcagacagaagaggaaggtctgggtgatgtcactggaaaagaaagcagaagaactc
acccagacaaacatgcaacttcagaatgaagtgtccatgttgaaaaatgaggtggcacag
ctgaaacagttgttgttaacgcataaagattgccccataacagccatgcagaaagaatcg
caaggatatctaagtccagagagcagccctcctgccagtcccgtccccacgtgctctcag
cagcaagtcatccagcataacaccatcaccacttcctcggcggtcagcgaagtggtggga
agctccaccctcagtcagctcaccactcacagaacagacctgaatcccattctctaa

KEGG   Camelus dromedarius (Arabian camel): 105102288Help
Entry
105102288         CDS       T04642                                 

Gene name
CREB3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04022  cGMP-PKG signaling pathway
cdk04024  cAMP signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04211  Longevity regulating pathway
cdk04261  Adrenergic signaling in cardiomyocytes
cdk04668  TNF signaling pathway
cdk04714  Thermogenesis
cdk04725  Cholinergic synapse
cdk04728  Dopaminergic synapse
cdk04911  Insulin secretion
cdk04915  Estrogen signaling pathway
cdk04916  Melanogenesis
cdk04918  Thyroid hormone synthesis
cdk04922  Glucagon signaling pathway
cdk04925  Aldosterone synthesis and secretion
cdk04926  Relaxin signaling pathway
cdk04927  Cortisol synthesis and secretion
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04931  Insulin resistance
cdk04934  Cushing syndrome
cdk04935  Growth hormone synthesis, secretion and action
cdk04962  Vasopressin-regulated water reabsorption
cdk05016  Huntington disease
cdk05030  Cocaine addiction
cdk05031  Amphetamine addiction
cdk05034  Alcoholism
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05203  Viral carcinogenesis
cdk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    105102288 (CREB3)
   04024 cAMP signaling pathway
    105102288 (CREB3)
   04022 cGMP-PKG signaling pathway
    105102288 (CREB3)
   04151 PI3K-Akt signaling pathway
    105102288 (CREB3)
   04152 AMPK signaling pathway
    105102288 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    105102288 (CREB3)
   04922 Glucagon signaling pathway
    105102288 (CREB3)
   04915 Estrogen signaling pathway
    105102288 (CREB3)
   04926 Relaxin signaling pathway
    105102288 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    105102288 (CREB3)
   04918 Thyroid hormone synthesis
    105102288 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    105102288 (CREB3)
   04916 Melanogenesis
    105102288 (CREB3)
   04925 Aldosterone synthesis and secretion
    105102288 (CREB3)
   04927 Cortisol synthesis and secretion
    105102288 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105102288 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    105102288 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    105102288 (CREB3)
   04728 Dopaminergic synapse
    105102288 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    105102288 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    105102288 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    105102288 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    105102288 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    105102288 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    105102288 (CREB3)
   05031 Amphetamine addiction
    105102288 (CREB3)
   05034 Alcoholism
    105102288 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105102288 (CREB3)
   04934 Cushing syndrome
    105102288 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105102288 (CREB3)
   05161 Hepatitis B
    105102288 (CREB3)
   05163 Human cytomegalovirus infection
    105102288 (CREB3)
   05165 Human papillomavirus infection
    105102288 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105102288 (CREB3)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    105102288 (CREB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf FhuF_C
Motif
Other DBs
NCBI-GeneID: 105102288
NCBI-ProteinID: XP_010993893
LinkDB All DBs
Position
4
AA seq 409 aa AA seqDB search
MPAPGCERRQGRPLYLHRARDVAPTAALPRQEDSKSRDASRMSHTELALDPGDHDLLDFL
LEESGGLGAAPDEALEASLDWELPFSEALNNWDIEDFLSSLSSPPPSLNVLSNSRRCLVH
HDHTYSLPQEHVSIDLEIESYGKEGAQMIPLSVEEPAEQEIAGLILTDEEKRLLDKEGLT
LPGTLPLTKMEEQVLKRVRRKIRNKKSAQESRRKKKVYVGGLESRVLKYTAQNLELQNRV
QLLEEQNLSLLDQLRRLQAMVIQTADKASSSSTCVLVLLFSFCLLFMPAMYSSNTRQNLP
AEHRVLSRQLRALPSEDPHQLELPALQSEVPKDNSDHKFQAPSNSCCLFYRMSQVPGAEC
SLKLPLLDHFSKSSCPGPILPLHANVTREGGWLPSCSPMSVILQGRYSG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccccggggtgtgagcggcggcagggacgtcccctctatttgcatagagcccgg
gacgtggcgccgaccgcggcgcttccgcgtcaggaggactccaagtcccgggatgcctcg
cggatgtctcatacggagctggcgttggacccaggtgatcatgacctgctggacttcctg
ctcgaggaaagcggaggtttgggggcggcgcccgacgaggcccttgaggcttccctggat
tgggagctgccgttttctgaggcactgaacaattgggacatagaggatttcctaagctcc
ctgtcgagccccccaccatcgttgaacgttctcagcaattctcgccgctgtcttgtccac
cacgatcacacctattctctcccacaggagcatgtgtccatagatctagagattgagagc
tatggaaaagagggggcgcagatgattccactttctgtggaagagccagcagagcaggag
attgctgggctaatactgacagatgaggagaagaggctattggacaaggagggacttact
ctgcctgggacacttcctctcactaagatggaggaacaagttctgaaacgggtgcggagg
aagattcgaaacaaaaagtctgctcaagagagccgcaggaagaagaaggtgtatgtgggg
ggtttagagagtagggtcttgaaatacacagcccagaatctggagctacagaacagagtc
cagctcctggaagaacagaatctgtcccttttggatcagctgaggagactccaggccatg
gtgattcagacagcagacaaagccagcagcagcagtacctgtgtcttggtcctgctgttc
tccttctgtcttctcttcatgcctgctatgtactcctctaacacaaggcagaacctgcca
gctgagcacagagtgttgtcccgccagcttcgtgccctccccagcgaggaccctcaccag
ctggagctgcctgccctgcagtcagaggtaccaaaggacaactcagatcacaaattccag
gctcctagcaactcttgctgcctgttctaccgcatgtctcaggttcctggtgcagagtgt
tccctgaagttgccactgcttgaccatttctcaaagtcctcctgcccaggtcctatctta
cccctgcatgcaaatgtcacgagagagggaggatggctccctagctgtagccccatgtct
gttatcttgcagggcagatactcaggctag

KEGG   Camelus dromedarius (Arabian camel): 105105303Help
Entry
105105303         CDS       T04642                                 

Gene name
CREB3L3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04022  cGMP-PKG signaling pathway
cdk04024  cAMP signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04211  Longevity regulating pathway
cdk04261  Adrenergic signaling in cardiomyocytes
cdk04668  TNF signaling pathway
cdk04714  Thermogenesis
cdk04725  Cholinergic synapse
cdk04728  Dopaminergic synapse
cdk04911  Insulin secretion
cdk04915  Estrogen signaling pathway
cdk04916  Melanogenesis
cdk04918  Thyroid hormone synthesis
cdk04922  Glucagon signaling pathway
cdk04925  Aldosterone synthesis and secretion
cdk04926  Relaxin signaling pathway
cdk04927  Cortisol synthesis and secretion
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04931  Insulin resistance
cdk04934  Cushing syndrome
cdk04935  Growth hormone synthesis, secretion and action
cdk04962  Vasopressin-regulated water reabsorption
cdk05016  Huntington disease
cdk05030  Cocaine addiction
cdk05031  Amphetamine addiction
cdk05034  Alcoholism
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05203  Viral carcinogenesis
cdk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    105105303 (CREB3L3)
   04024 cAMP signaling pathway
    105105303 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    105105303 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    105105303 (CREB3L3)
   04152 AMPK signaling pathway
    105105303 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    105105303 (CREB3L3)
   04922 Glucagon signaling pathway
    105105303 (CREB3L3)
   04915 Estrogen signaling pathway
    105105303 (CREB3L3)
   04926 Relaxin signaling pathway
    105105303 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    105105303 (CREB3L3)
   04918 Thyroid hormone synthesis
    105105303 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    105105303 (CREB3L3)
   04916 Melanogenesis
    105105303 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    105105303 (CREB3L3)
   04927 Cortisol synthesis and secretion
    105105303 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105105303 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    105105303 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    105105303 (CREB3L3)
   04728 Dopaminergic synapse
    105105303 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    105105303 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    105105303 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    105105303 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    105105303 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    105105303 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    105105303 (CREB3L3)
   05031 Amphetamine addiction
    105105303 (CREB3L3)
   05034 Alcoholism
    105105303 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105105303 (CREB3L3)
   04934 Cushing syndrome
    105105303 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105105303 (CREB3L3)
   05161 Hepatitis B
    105105303 (CREB3L3)
   05163 Human cytomegalovirus infection
    105105303 (CREB3L3)
   05165 Human papillomavirus infection
    105105303 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105105303 (CREB3L3)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    105105303 (CREB3L3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf KASH_CCD DUF2207 ADIP SOGA DUF4407
Motif
Other DBs
NCBI-GeneID: 105105303
NCBI-ProteinID: XP_031292821
LinkDB All DBs
Position
22
AA seq 458 aa AA seqDB search
MDGDLAAGKMTSSTSPTGPIDSLELLDLLFDRQDGILRHVELGEDWGHVDDQQVLPGPDS
DDFLNSILGSGDSVPNSPTWSPAGSDSGISEDLPSDPQDTPPRGGVAATPVSCHTTESGK
ELCLSYHPGPLYPTRHPGPVAHGLEASVAIDLEAWSPGLHTEERAGPAGSPPRRSPTVKD
LLLSGSGGATQHHLAAPHLLRPGTGHCQELVLTEDEKKLLAKEGITLPTQLPLTKYEERV
LKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLEQL
KKLQAIVVQSTTKSAHTGTCIAVLLFSFALIVLPSISPFASNKAESPGDFTPVRVFSRTL
HNDGASRVAPDAAPSSEAPGPWPEAGVLQEGSPGSPGGYWGSRDTPSVDNSTEDLDNSTL
VQGTEMKELDRATLLDCAPPKPALSPGQVGLEAAGGEL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggatggggatttagcggctggaaagatgacttcctccaccagtcccacgggccccatc
gacagcctggagctcttggatctcctgtttgacaggcaggatggcatcttgagacatgta
gagctgggcgaggactggggccacgtcgatgatcagcaggtcctgccaggcccggactct
gatgatttcctcaactccattctgggttctggagattcagtgcccaactccccgacctgg
tctcctgcaggcagtgacagtggcatctcagaagatctgccctctgacccccaagacacc
cctccacgtggtggggtggctgccaccccagtcagctgccataccacggagtctggcaag
gagctctgcctctcctaccatcctgggcccctctaccccaccaggcaccctgggccagta
gcccacgggctcgaggcctccgtggccatagacctggaagcgtggagcccaggactgcac
accgaggagcgggctgggccggccggctcacccccgcgccgcagccccacggtgaaggac
ctcctgctctccggcagcggcggggccacgcaacatcacctggcagccccccacctgttg
cgacctgggaccgggcactgccaggagctggtgctgacggaggatgagaagaagctgctg
gccaaagaaggcatcaccctgcccacacagctgcccctcaccaagtatgaggaacgagtg
ctgaaaaaaattcgccggaaaatccgaaacaaacagtcggcccaagaaagccggaaaaag
aagaaggaatatattgacggcctggaaactcggatgtcagcctgtactgcccagaaccag
gagcttcagaggaaggtcttacatcttgagaagcagaacctgtccctcttggagcagctg
aagaaactccaggccattgtggtccagtccaccaccaagtcagctcacacaggcacttgc
atagcggtcctgctcttctctttcgccctcatcgtcctcccctccatcagccctttcgcc
tccaacaaagctgagagccccggagacttcacacctgtgcgagttttctccagaactttg
cacaacgacggtgcatctcgagtggccccagatgctgcaccaagctccgaggccccagga
ccctggcccgaggctggtgtacttcaggaagggtctccaggcagccccggggggtactgg
ggatcccgggacacgccgtctgtggacaactcgacagaggatctagacaactctaccctg
gtccagggcactgagatgaaggagctggatcgggccaccctgctggactgtgctccacct
aagccagcactcagcccgggacaagtggggctggaggcggcaggtggggagctgtga

KEGG   Camelus dromedarius (Arabian camel): 105106926Help
Entry
105106926         CDS       T04642                                 

Gene name
CREB3L1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04022  cGMP-PKG signaling pathway
cdk04024  cAMP signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04152  AMPK signaling pathway
cdk04211  Longevity regulating pathway
cdk04261  Adrenergic signaling in cardiomyocytes
cdk04668  TNF signaling pathway
cdk04714  Thermogenesis
cdk04725  Cholinergic synapse
cdk04728  Dopaminergic synapse
cdk04911  Insulin secretion
cdk04915  Estrogen signaling pathway
cdk04916  Melanogenesis
cdk04918  Thyroid hormone synthesis
cdk04922  Glucagon signaling pathway
cdk04925  Aldosterone synthesis and secretion
cdk04926  Relaxin signaling pathway
cdk04927  Cortisol synthesis and secretion
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04931  Insulin resistance
cdk04934  Cushing syndrome
cdk04935  Growth hormone synthesis, secretion and action
cdk04962  Vasopressin-regulated water reabsorption
cdk05016  Huntington disease
cdk05030  Cocaine addiction
cdk05031  Amphetamine addiction
cdk05034  Alcoholism
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05203  Viral carcinogenesis
cdk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    105106926 (CREB3L1)
   04024 cAMP signaling pathway
    105106926 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    105106926 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    105106926 (CREB3L1)
   04152 AMPK signaling pathway
    105106926 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    105106926 (CREB3L1)
   04922 Glucagon signaling pathway
    105106926 (CREB3L1)
   04915 Estrogen signaling pathway
    105106926 (CREB3L1)
   04926 Relaxin signaling pathway
    105106926 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    105106926 (CREB3L1)
   04918 Thyroid hormone synthesis
    105106926 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    105106926 (CREB3L1)
   04916 Melanogenesis
    105106926 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    105106926 (CREB3L1)
   04927 Cortisol synthesis and secretion
    105106926 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105106926 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    105106926 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    105106926 (CREB3L1)
   04728 Dopaminergic synapse
    105106926 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    105106926 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    105106926 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    105106926 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    105106926 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    105106926 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    105106926 (CREB3L1)
   05031 Amphetamine addiction
    105106926 (CREB3L1)
   05034 Alcoholism
    105106926 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105106926 (CREB3L1)
   04934 Cushing syndrome
    105106926 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105106926 (CREB3L1)
   05161 Hepatitis B
    105106926 (CREB3L1)
   05163 Human cytomegalovirus infection
    105106926 (CREB3L1)
   05165 Human papillomavirus infection
    105106926 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105106926 (CREB3L1)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    105106926 (CREB3L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 LMBR1 bZIP_Maf APG6_N ELP6 DUF3461
Motif
Other DBs
NCBI-GeneID: 105106926
NCBI-ProteinID: XP_031315582
LinkDB All DBs
Position
10
AA seq 522 aa AA seqDB search
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPIVPIKMEDTTQDVEHGAWVLG
HTLCSVMVKQEQSPELPVDPLAASSAMAAAAAMATTPLLGLSPLSRLPVPHQAPGEMTQL
PVIKAEPQEVNQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPIRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLERSKEVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVT
NKISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPMATDSVYAAS
QMPSRSLLFYDESAGSWEDGPSALLPMEPPDGWEIKPGGSAEQRPQDHLQHDHLDSTHET
SKYLSEAWPKDVGGNNTSPDFSHPKEWFHERDLGPNTTIKLS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgtcttagagcccttcccggccgacaggctgttccccggatccagcttcctg
gacttgggggatctgaacgagtcggatttcctcaacaatgcgcacttccctgagcacctg
gaccacttcacagagaacatggaagacttctccaatgacctgttcagcagtttctttgat
gaccctgtgctggacgagaagagccctctactggacatggaactggactcccccacaccg
ggcatccaggctgagcacagctactccctgagcggtgactcagcacctcagagccccatc
gtgcccatcaagatggaggataccacccaagacgtcgaacatggagcatgggtgctggga
cacacactgtgctccgtcatggtgaagcaggagcagagcccggagctgcccgtggaccct
ctggctgcctcctcggccatggctgctgctgctgccatggccaccaccccgctgctgggc
ctcagccctctgtccaggctgcccgtcccccaccaggccccgggagagatgactcagctg
ccagtgatcaaagcagagccccaggaggtgaaccagttcctcaaagtgacaccagaggac
ctggtacagatgcctccaacaccccccagcagccatggcagcgacagtgacggctcgcag
agtccccgctctctgcccccctccagccctatccggcccatggcccgctcctccacagcc
atctccacctcccccctcctcaccgcccctcacaaattacaggggacgtcagggccgctg
ctcctgacggaggaagagaagcgtaccctgattgctgagggctaccccatccccaccaaa
cttcccctcaccaaagctgaggaaaaggccttgaagagggtccggagaaaaatcaagaac
aagatctcagcccaggagagccgccgtaagaagaaggaatacgtggagtgtctagaaaga
agtaaggaagtggagacatttacatcggagaacaatgaactgtggaagaaggtggaaacc
ctggagaatgccaacaggaccctgctccagcagctgcagaaactccagactctggtcacc
aacaagatctccagaccttacaagatggctgccacccagactgggacctgcctcatggtg
gcagccttatgctttgttctggtgctgggctcccttgtgccctgcctccctgagttctcc
tccggctcccagactgtgaaggaagaccccatggccactgacagcgtctacgcggccagt
cagatgccctcccgaagcctcctgttctatgacgagagcgcaggctcgtgggaggacggc
cccagcgccctgctgcccatggagcccccagatggctgggagatcaagcctggggggtcg
gcagagcagcgaccccaggaccacctgcagcacgaccacctggacagcacccacgagacc
agcaagtacctgagtgaggcctggccaaaggacgtcggtggaaacaacaccagtcctgac
ttctcccaccctaaggagtggttccacgagagggatctgggccccaacaccaccatcaaa
ctctcctag

DBGET integrated database retrieval system