KEGG   Camelus dromedarius (Arabian camel): 105089471
Entry
105089471         CDS       T04642                                 

Gene name
HMGCS2
Definition
(RefSeq) hydroxymethylglutaryl-CoA synthase, mitochondrial
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00072  Synthesis and degradation of ketone bodies
cdk00280  Valine, leucine and isoleucine degradation
cdk00650  Butanoate metabolism
cdk00900  Terpenoid backbone biosynthesis
cdk01100  Metabolic pathways
cdk03320  PPAR signaling pathway
Module
cdk_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    105089471 (HMGCS2)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    105089471 (HMGCS2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    105089471 (HMGCS2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    105089471 (HMGCS2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105089471 (HMGCS2)
Enzymes [BR:cdk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     105089471 (HMGCS2)
SSDB
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N DUF627
Other DBs
NCBI-GeneID: 105089471
NCBI-ProteinID: XP_010978828
LinkDB
Position
9
AA seq 508 aa
MQRLLTPVRGVLQVRRVVQEASLVPARLLPAAHQRFSTVPAVPLAKTDTWPKDVGILALE
VYFPAQYVDQTDLEKFNKVEAGKYTVGLGQTHMGFCSVQEDINSLCLTVVQRLMERTQLP
WDSVGWLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIGNTNACYGGTASLFNAANWM
ESSSWDGRYAVVVCGDIAVYPVGNIRPIGGAGAVAMLVGPKAPLALERGLRGTHMENVYD
FYKPDMTSEYPLADGKLSIQCYLQALDRCYTLYRQKIQNQWKQDGINQPFTLDDLQFIIF
HTPFCKMVQKSLGHLMFNDFLSASGNRQTSLYKGLEAFRGLKLEDSYTNKDIEKAFLKAS
LDMFHKKTKASLYLSTHNGNMYTSSLYGCLASLLSRHSAQDLAGSRIGAFSYGSGLAASF
FSFRVSQDASPGSPLEKLVSSTSDLPKRLASRKRVSPEEFTEIMEQREQFYQKVNFSPPG
DKSSLFPGTWYLERVDEMYRRKYARRPV
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgcagcggctgttgactccagtgaggggggtcttgcaagtgaggagagtggtacaggaa
gcttccctcgtgccagctcgccttctcccggcagcccaccaaaggttttctacagttcct
gctgtccccttggccaaaacagatacttggccaaaggatgtgggcatccttgccctggag
gtctatttcccagcccaatacgtggaccaaacagacctggagaagtttaacaaggtggag
gcagggaagtacacagtgggcttgggccaaacccacatgggcttctgctcagtccaggag
gacatcaactccctgtgcctgacggtggtgcagcggctgatggaacgcacacagctcccg
tgggactctgtgggctggctggaagtgggcactgagaccatcatcgacaagtccaaggct
gtcaaaacagtgctcatggagctcttccaggattcaggcaacactgacattgagggcata
ggtaacaccaatgcctgctacggtggcactgcctccctcttcaacgcagccaactggatg
gagtccagctcctgggatggtcgctacgcagtggtggtctgtggagacatcgcagtgtac
cctgttggtaacattcgccccattggtggggccggagcggtggcaatgctggttgggcct
aaggcccctctggccctggagagagggcttagaggaacccacatggagaatgtatatgac
ttctacaaaccagatatgacttcagagtacccactggcggatgggaagctctccatccaa
tgctacttacaggccctggaccgatgctacacgttataccgtcaaaagatccagaaccag
tggaagcaagatggcatcaatcagcctttcactctcgacgatctgcagtttataatcttt
cacacacccttctgcaagatggtccagaagtccctgggtcacctgatgttcaatgacttc
ctgtcagccagtggcaacaggcagaccagcctctacaaggggctggaggccttcaggggg
ctgaagctggaagacagctacaccaataaggacatagagaaagcgtttctgaaggcctct
ctggacatgttccacaagaaaaccaaggcctccctgtacctctccacccacaacgggaat
atgtacacctcgtccctctacggatgcctggcctcgcttctgtcccgtcactctgcccag
gacttggctggctccaggattggcgccttctcttatggctctggcttggcagcaagtttc
ttttcatttcgagtgtcccaagatgcttctcctggctcccctctggagaagctggtgtct
agtacatcagatctgccaaaacgtcttgcctcccggaagcgtgtgtctcctgaggaattc
acagaaataatggaacaaagagaacaattctaccagaaggtgaatttctcaccacctggt
gacaaaagcagccttttcccaggcacctggtacctggagcgagtggatgagatgtatcgc
agaaagtatgcccggcgaccggtctaa

KEGG   Camelus dromedarius (Arabian camel): 105107063
Entry
105107063         CDS       T04642                                 

Gene name
HMGCS1
Definition
(RefSeq) hydroxymethylglutaryl-CoA synthase, cytoplasmic isoform X1
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00072  Synthesis and degradation of ketone bodies
cdk00280  Valine, leucine and isoleucine degradation
cdk00650  Butanoate metabolism
cdk00900  Terpenoid backbone biosynthesis
cdk01100  Metabolic pathways
cdk03320  PPAR signaling pathway
Module
cdk_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    105107063 (HMGCS1)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    105107063 (HMGCS1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    105107063 (HMGCS1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    105107063 (HMGCS1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105107063 (HMGCS1)
Enzymes [BR:cdk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     105107063 (HMGCS1)
SSDB
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N Cullin ACP_syn_III
Other DBs
NCBI-GeneID: 105107063
NCBI-ProteinID: XP_010999190
LinkDB
Position
3
AA seq 545 aa
MLPEGGNRVTDLETAALYPSHSSFIMPGSLPLNAEACWPKDVGIVALEIYFPSQYVDQAE
LEKYDGVDAGKYTIGLGQAKMGFCTDREDINSLCMTVVQNLMERNSLSYDCIGRLEVGTE
TIIDKSKSVKTNLMQLFEESGNTDIEGIDTTNACYGGTAAVFNAVNWIESSSWDGRYALV
VAGDIAVYATGNARPTGGVGAVAMLIGPNAPLIFERGLRGTHMQHAYDFYKPDMLSEYPI
VDGKLSIQCYLSALDRCYSVYRKKIHARWQKEGNDKDFTLNDFGFMIFHSPYCKLVQKSL
ARMLLNDFLNDQNRDKNSIYSGLEAFGDVKLEDTYFDRDVEKAFMKASSELFNQKTKASL
LVSNQNGNMYTSSVYGSLASILAQYSPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPG
SALDKIIASLCDLKSRLDSRTCVAPDVFAENMKLREDTHHLGNYIPQSSVDSLFEGTWYL
VRVDEKHRRTYARRPSLNDDTLDEGVGLVHSSTAAEHIPSPAKKVPRLPATAAEPEAAVI
SNGEH
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgttgcctgaaggaggaaacagagtgacagacctggagactgcagctctttatccctct
cacagttctttcatcatgcctgggtcacttcctttgaatgcagaagcctgctggccaaaa
gatgtgggaattgttgcccttgagatctattttccttctcaatatgttgatcaagcagag
ttggaaaaatacgatggtgtagatgctggaaagtatactattggcttgggccaggccaag
atgggcttctgcacggatagagaagatatcaactctctttgcatgactgtggttcagaat
cttatggagagaaatagcctttcttatgattgcattgggcggctagaagttggaacagag
acgatcatcgacaaatcaaagtcagtgaagactaatctgatgcagctctttgaggagtct
gggaatacagacatagaagggatagacacgactaatgcgtgctatggaggcacagctgct
gtcttcaatgctgtcaactggatcgagtccagctcttgggatggacggtatgccctggta
gttgcaggggatattgctgtatatgccacaggaaatgctagacctacgggtggagttgga
gccgttgctatgctaattgggccaaatgctcctttaatttttgaacgaggacttcgtgga
acacatatgcaacacgcctatgacttttacaagcctgatatgctgtctgaatatcctata
gtagatggaaaactctccatacagtgttacctcagtgcattagaccgctgctattctgtc
taccgcaagaagatccatgcccggtggcagaaagagggaaatgataaagatttcaccttg
aatgactttggtttcatgatcttccactcaccctattgtaaactggttcagaaatctcta
gcacggatgttgctgaatgacttccttaatgaccagaacagagataaaaatagtatctat
agtggcctagaagcctttggggatgttaaattagaagatacctactttgatagagatgtg
gaaaaggcatttatgaaggctagttcagaactctttaatcagaaaacaaaggcatctttg
cttgtgtcaaatcaaaatggaaatatgtatacatcttcagtatatggttcccttgcttct
attcttgcacagtactcacctcagcagctggcgggaaagaggattggcgtgttctcttat
ggctctggtttggctgccaccctgtactccctcaaagttacacaagatgccacgccaggg
tctgctcttgataaaataatagcaagtttatgtgatctcaaatcaaggcttgactcaaga
acttgtgtggcaccagatgtctttgctgaaaacatgaagctcagagaagacactcatcac
ttgggcaactatattccccagagttcagttgattcgctctttgaaggaacgtggtaccta
gttcgagtggatgaaaagcacagaaggacttacgctcggcgcccctctctgaatgatgac
actttggatgaaggggtaggactcgtgcattcaagcacagcagctgagcatattccaagt
cctgctaagaaagtgccaagactccctgcaacagcagcagaaccagaagcagctgtcatc
agtaacggggagcactga

DBGET integrated database retrieval system