KEGG   Camelus dromedarius (Arabian camel): 105089526
Entry
105089526         CDS       T04642                                 

Gene name
HPGDS
Definition
(RefSeq) hematopoietic prostaglandin D synthase
  KO
K04097  prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00480  Glutathione metabolism
cdk00590  Arachidonic acid metabolism
cdk00980  Metabolism of xenobiotics by cytochrome P450
cdk00982  Drug metabolism - cytochrome P450
cdk01100  Metabolic pathways
cdk05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    105089526 (HPGDS)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105089526 (HPGDS)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    105089526 (HPGDS)
   00982 Drug metabolism - cytochrome P450
    105089526 (HPGDS)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    105089526 (HPGDS)
Enzymes [BR:cdk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     105089526 (HPGDS)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     105089526 (HPGDS)
SSDB
Motif
Pfam: GST_C_3 GST_N GST_N_3 GST_C GST_N_2 GST_C_6 GST_N_4
Other DBs
NCBI-GeneID: 105089526
NCBI-ProteinID: XP_010978889
LinkDB
Position
2
AA seq 199 aa
MPNYKLIYFNMRGRAEIIRYIFAYLDIKYEDHRLEQADWPEIKSTLPFGKIPILEVDGLN
LHQSLAIARYLTRNTDLAGKTDLEQCQVDAIVDTLDDFMSCFPWAEKKQDVKDQMFKELL
TCDAPHLLQDLDTYLGEKEWFIGNSVTWADFYWEICSTTLLVFKPDLLDIHPRLVTLRRK
VQSIPAIADWIQQRPQTKL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgccaaactacaaactcatttactttaatatgagggggagagcagaaattattcggtac
atatttgcatatttggacataaagtatgaagaccacagactagaacaagctgattggcct
gaaatcaaatcaactcttccatttggcaaaattcccattttggaagtcgatggacttaac
cttcaccagagcctagcaatcgcaagatatttgaccagaaacacagatttggctggaaaa
acagacttggaacaatgtcaagttgatgcaatcgtggacacgttggacgatttcatgtca
tgttttccttgggcagagaaaaaacaagatgtaaaagatcagatgtttaaggagctactt
acatgtgatgcacctcatcttctgcaagatttggacacatatttaggggaaaaagagtgg
tttattggtaactctgtaacttgggcagacttctactgggaaatctgcagtaccacactt
ttggtctttaaacctgatttgttggacatccatcccaggctggtgacattacgcaggaaa
gtccaaagcattcctgccatagctgactggatacagcaaaggccgcaaaccaaactctag

KEGG   Camelus dromedarius (Arabian camel): 105106194
Entry
105106194         CDS       T04642                                 

Gene name
PTGDS
Definition
(RefSeq) prostaglandin-H2 D-isomerase
  KO
K01830  prostaglandin-H2 D-isomerase [EC:5.3.99.2]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00590  Arachidonic acid metabolism
cdk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    105106194 (PTGDS)
Enzymes [BR:cdk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     105106194 (PTGDS)
SSDB
Motif
Pfam: Lipocalin VDE Triabin DUF2953
Other DBs
NCBI-GeneID: 105106194
NCBI-ProteinID: XP_010998336
UniProt: A0A5N4E8E4
LinkDB
Position
4
AA seq 191 aa
MATQSTLWTGLVLLGVLGALQIPTQAQVSLQPNFQEEKFLGRWFTAGLASNASWFLEKKA
MLSMCKSVVVRAADGGLNLTSTFLRKDQCETRTLLLRPADPPGCYSYVSPHWGNNHEVSV
VETDYDVYALLYTEGVKGLAQDFRMATLYSRTQAPSAQVKEKFSTFAKAQGFTEDSIVFL
PKADKCMGEHA
NT seq 576 nt   +upstreamnt  +downstreamnt
atggccactcagagcactctgtggacggggctggtcctgctgggggtcctgggggccctg
cagatccctacccaggcccaggtctccctgcagcccaacttccaagaggagaagttcctg
ggacgctggttcaccgcgggcctcgcctccaacgcaagctggttcctggaaaagaaggcg
atgctgtccatgtgcaagtctgtggtggtccgggcggcagatggtggcctcaacctcacc
tctaccttcctcagaaaagaccagtgtgagacccggactctgctgctgcgtcctgcagac
cccccaggctgctacagctacgtcagtccccactggggcaacaaccacgaggtgtcggtg
gtggagaccgattacgatgtgtacgcactgctctacactgagggtgttaaaggcctggcc
caggacttccgcatggccaccctctacagccgcacccaggccccgagtgcccaggtaaag
gagaaattcagcaccttcgccaaggcccagggcttcacagaggacagcattgtcttcctg
ccgaaggctgacaagtgcatgggggagcatgcatag

DBGET integrated database retrieval system