KEGG   Camelus dromedarius (Arabian camel): 105089630
Entry
105089630         CDS       T04642                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk04010  MAPK signaling pathway
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04062  Chemokine signaling pathway
cdk04068  FoxO signaling pathway
cdk04071  Sphingolipid signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04137  Mitophagy - animal
cdk04140  Autophagy - animal
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04210  Apoptosis
cdk04211  Longevity regulating pathway
cdk04213  Longevity regulating pathway - multiple species
cdk04218  Cellular senescence
cdk04360  Axon guidance
cdk04370  VEGF signaling pathway
cdk04371  Apelin signaling pathway
cdk04540  Gap junction
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04625  C-type lectin receptor signaling pathway
cdk04650  Natural killer cell mediated cytotoxicity
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04664  Fc epsilon RI signaling pathway
cdk04714  Thermogenesis
cdk04720  Long-term potentiation
cdk04722  Neurotrophin signaling pathway
cdk04725  Cholinergic synapse
cdk04726  Serotonergic synapse
cdk04730  Long-term depression
cdk04810  Regulation of actin cytoskeleton
cdk04910  Insulin signaling pathway
cdk04912  GnRH signaling pathway
cdk04915  Estrogen signaling pathway
cdk04916  Melanogenesis
cdk04917  Prolactin signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk04921  Oxytocin signaling pathway
cdk04926  Relaxin signaling pathway
cdk04929  GnRH secretion
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk04935  Growth hormone synthesis, secretion and action
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05034  Alcoholism
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05207  Chemical carcinogenesis - receptor activation
cdk05208  Chemical carcinogenesis - reactive oxygen species
cdk05210  Colorectal cancer
cdk05211  Renal cell carcinoma
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05216  Thyroid cancer
cdk05218  Melanoma
cdk05219  Bladder cancer
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05230  Central carbon metabolism in cancer
cdk05231  Choline metabolism in cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cdk05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105089630 (NRAS)
   04012 ErbB signaling pathway
    105089630 (NRAS)
   04014 Ras signaling pathway
    105089630 (NRAS)
   04015 Rap1 signaling pathway
    105089630 (NRAS)
   04370 VEGF signaling pathway
    105089630 (NRAS)
   04371 Apelin signaling pathway
    105089630 (NRAS)
   04068 FoxO signaling pathway
    105089630 (NRAS)
   04072 Phospholipase D signaling pathway
    105089630 (NRAS)
   04071 Sphingolipid signaling pathway
    105089630 (NRAS)
   04151 PI3K-Akt signaling pathway
    105089630 (NRAS)
   04150 mTOR signaling pathway
    105089630 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105089630 (NRAS)
   04137 Mitophagy - animal
    105089630 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    105089630 (NRAS)
   04218 Cellular senescence
    105089630 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    105089630 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    105089630 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105089630 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    105089630 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    105089630 (NRAS)
   04660 T cell receptor signaling pathway
    105089630 (NRAS)
   04662 B cell receptor signaling pathway
    105089630 (NRAS)
   04664 Fc epsilon RI signaling pathway
    105089630 (NRAS)
   04062 Chemokine signaling pathway
    105089630 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105089630 (NRAS)
   04929 GnRH secretion
    105089630 (NRAS)
   04912 GnRH signaling pathway
    105089630 (NRAS)
   04915 Estrogen signaling pathway
    105089630 (NRAS)
   04917 Prolactin signaling pathway
    105089630 (NRAS)
   04921 Oxytocin signaling pathway
    105089630 (NRAS)
   04926 Relaxin signaling pathway
    105089630 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    105089630 (NRAS)
   04919 Thyroid hormone signaling pathway
    105089630 (NRAS)
   04916 Melanogenesis
    105089630 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    105089630 (NRAS)
   04726 Serotonergic synapse
    105089630 (NRAS)
   04720 Long-term potentiation
    105089630 (NRAS)
   04730 Long-term depression
    105089630 (NRAS)
   04722 Neurotrophin signaling pathway
    105089630 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    105089630 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    105089630 (NRAS)
   04213 Longevity regulating pathway - multiple species
    105089630 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    105089630 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105089630 (NRAS)
   05206 MicroRNAs in cancer
    105089630 (NRAS)
   05205 Proteoglycans in cancer
    105089630 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    105089630 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    105089630 (NRAS)
   05203 Viral carcinogenesis
    105089630 (NRAS)
   05230 Central carbon metabolism in cancer
    105089630 (NRAS)
   05231 Choline metabolism in cancer
    105089630 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105089630 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105089630 (NRAS)
   05225 Hepatocellular carcinoma
    105089630 (NRAS)
   05226 Gastric cancer
    105089630 (NRAS)
   05214 Glioma
    105089630 (NRAS)
   05216 Thyroid cancer
    105089630 (NRAS)
   05221 Acute myeloid leukemia
    105089630 (NRAS)
   05220 Chronic myeloid leukemia
    105089630 (NRAS)
   05218 Melanoma
    105089630 (NRAS)
   05211 Renal cell carcinoma
    105089630 (NRAS)
   05219 Bladder cancer
    105089630 (NRAS)
   05215 Prostate cancer
    105089630 (NRAS)
   05213 Endometrial cancer
    105089630 (NRAS)
   05224 Breast cancer
    105089630 (NRAS)
   05223 Non-small cell lung cancer
    105089630 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105089630 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    105089630 (NRAS)
   05161 Hepatitis B
    105089630 (NRAS)
   05160 Hepatitis C
    105089630 (NRAS)
   05163 Human cytomegalovirus infection
    105089630 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105089630 (NRAS)
   05165 Human papillomavirus infection
    105089630 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105089630 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    105089630 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    105089630 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    105089630 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105089630 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105089630 (NRAS)
   01522 Endocrine resistance
    105089630 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdk04131]
    105089630 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105089630 (NRAS)
   04031 GTP-binding proteins [BR:cdk04031]
    105089630 (NRAS)
Membrane trafficking [BR:cdk04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    105089630 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    105089630 (NRAS)
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105089630 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   105089630 (NRAS)
  Exosomal proteins of breast cancer cells
   105089630 (NRAS)
  Exosomal proteins of colorectal cancer cells
   105089630 (NRAS)
GTP-binding proteins [BR:cdk04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    105089630 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 105089630
NCBI-ProteinID: XP_010979017
LinkDB
Position
9:complement(19045707..19055665)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaagtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aaacgagtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca
ttcatcgaaacctcagccaagaccagacagggtgttgaagatgccttttatacactggta
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatggaactcaaggt
tgtatggggttgccgtgtgtggtgatgtaa

DBGET integrated database retrieval system