KEGG   Camelus dromedarius (Arabian camel): 105089692Help
Entry
105089692         CDS       T04642                                 

Gene name
GALNT17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00512  Mucin type O-glycan biosynthesis
cdk00514  Other types of O-glycan biosynthesis
cdk01100  Metabolic pathways
Module
cdk_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    105089692 (GALNT17)
   00514 Other types of O-glycan biosynthesis
    105089692 (GALNT17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cdk01003]
    105089692 (GALNT17)
Enzymes [BR:cdk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     105089692 (GALNT17)
Glycosyltransferases [BR:cdk01003]
 O-Glycan biosynthesis
  Mucin-type
   105089692 (GALNT17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 105089692
NCBI-ProteinID: XP_031288645
LinkDB All DBs
Position
18
AA seq 521 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEAANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKEMKYSKELPQMSIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDTFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
RGRWRTTQQSCPVPWLGTPAGPLHQGGLPAPGSPGDHHASP
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgctgctggtgttgaacttgatcgctgtggccggc
ttcgtgctcttcctggccaagtgccggcccatcgcggtgcgcagcggagacgccttccac
gagattcggccgcgcgcggaggcggccaacctaagcgcgcacagcgccagccccatccag
gatgcggtcctgaagcgcctttcactgctcgaggacattgtctaccggcaactaaatggt
ttatccaaatcccttgggctcattgaaggttacggtgggcggggcaaagggggccttcct
gctaccctttccccagctgaagaggagaaagccaaggggcctcatgagaagtatggctac
aattcctacctcagtgaaaaaatctcactggatcgttccattccggattatcgtcccacc
aagtgtaaggagatgaagtactccaaggagctgccccagatgtccattatatttatcttt
gtgaacgaggccctgtcggtgatcctgcggtcagtccatagtgcggtcaaccacacgccg
acccacctgctgaaggaaatcatcctggtggacgacaacagtgatgaagaggaactgaag
gcccccttggaggagtatgtccacaaacgttaccccgggctcgtgaaggtggtgagaaat
caaaagagagagggcctgatccgagctcgcatcgagggctggaaggtggccactggccag
gtcaccggcttctttgatgcccacgtggagttcaccgctggctgggccgagccggttctg
tcccggatccaggagaaccggaagcgcgtgatcctcccctccattgacaacatcaagcag
gacacgttcgaggtgcagcggtacgagaactcggcccacgggtacagctgggagctgtgg
tgcatgtacatcagccccccgaaggactggtgggacgccggggacccttccctccccatc
aggacaccagccatgattggctgctcgtttgtggtcaacaggaagttctttggtgaaatt
ggtcttctggaccctgggatggatgtgtatggaggagaaaatatcgaacttggaatcaag
gtgtggctctgcgggggcagcatggaggtcctgccgtgctcacgggtggcccacatcgag
cgaaagaagaagccatacaacagcaacatcggcttctacaccaagaggaatgccctccgg
gtcgccgaggtctggatggatgattacaagtcacatgtgtacatagcgtggaatctgcca
ctggagaatccaggaattgacataggtgatgtctccgaaagaaaagccttaaggaaaagt
ttaaagtgtaagaatttccagtggtacctggaccacgtctacccggaaatgagaagatac
aataacaccgttgcctatggggagcttcgcaacaacaaggcaaaagacgtctgcttggac
cggggccgctggagaaccacacagcaatcctgtcccgtgccatggctggggaccccagct
ggcccgctacaccaaggagggcttcctgcacctgggagccctggggaccaccacgcttct
ccctga

DBGET integrated database retrieval system