KEGG   Camelus dromedarius (Arabian camel): 105089785Help
Entry
105089785         CDS       T04642                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00010  Glycolysis / Gluconeogenesis
cdk00053  Ascorbate and aldarate metabolism
cdk00071  Fatty acid degradation
cdk00260  Glycine, serine and threonine metabolism
cdk00280  Valine, leucine and isoleucine degradation
cdk00310  Lysine degradation
cdk00330  Arginine and proline metabolism
cdk00340  Histidine metabolism
cdk00380  Tryptophan metabolism
cdk00410  beta-Alanine metabolism
cdk00561  Glycerolipid metabolism
cdk00620  Pyruvate metabolism
cdk01100  Metabolic pathways
Module
cdk_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
cdk_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105089785 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    105089785 (ALDH7A1)
   00620 Pyruvate metabolism
    105089785 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105089785 (ALDH7A1)
   00561 Glycerolipid metabolism
    105089785 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    105089785 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    105089785 (ALDH7A1)
   00310 Lysine degradation
    105089785 (ALDH7A1)
   00330 Arginine and proline metabolism
    105089785 (ALDH7A1)
   00340 Histidine metabolism
    105089785 (ALDH7A1)
   00380 Tryptophan metabolism
    105089785 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105089785 (ALDH7A1)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     105089785 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     105089785 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     105089785 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 105089785
NCBI-ProteinID: XP_010979201
LinkDB All DBs
Position
Un
AA seq 566 aa AA seqDB search
MGSPGRGAGLYFSRASGRRRGALPWLSMWRVPGLLCVRVARRSKLSGPWNRPAAFMSTLL
INQPQYAWLKELGLREENDGVYNGSWGGRGEVITTYCPANNEPIARVRQASMADYEETVK
KAREAWRIWADIPAPKRGEVVRQIGDALREKIQVLGSLVSLEMGKILVEGVGEVQEYVDI
CDYAVGLSRMIGGPILPSERPGHVLVEQWNPVGLVGVITAFNFPVAVYGWNNAIAMICGN
ACLWKGAPTTSLISVAVTKIIAKVLEDNELPGAICSLTCGGADIGTAMAKDERVNLLSFT
GSTQVGKQVALMVQERFGRSLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAGQRCTTA
RRLFLQESIHDEVVNRLKKAYAQIRVGNPWDSNVLYGPLHTKQAVSMFLGAVEEAKKEGG
TVVYGGKVMDRPGNYVEPTIVTGLDHSAPIAHTETFAPILYVFKFKNEDEVFVWNNEVKQ
GLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAW
KQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgggctctcccgggcggggggcggggctctatttcagccgcgcctcgggccgcaggcgc
ggtgcgctcccctggcttagtatgtggcgcgttcccggtctgctgtgcgtgcgcgttgca
aggaggagcaagctctccggaccttggaacaggcctgccgccttcatgtccactctgctc
atcaatcagccccagtatgcttggctgaaggagctggggctccgcgaggaaaacgacggc
gtgtataatggcagctggggaggccggggagaggttatcaccacctattgtcctgctaac
aatgagccgatagcaagagtcagacaggccagcatggctgactacgaagaaactgtaaag
aaagcaagagaagcatggagaatctgggcagatattcctgctccaaagcgaggagaagta
gtgagacagattggtgatgccttgcgggagaagatccaagtactaggaagcttggtgtca
ttggagatggggaagatcttagtggaaggtgtgggagaagttcaggagtacgtggatatt
tgtgattatgccgtgggcttatcacggatgatcgggggacccatcctgccgtctgaaaga
cccggccacgtgctcgttgaacagtggaaccctgtaggcctggtcggagtcatcactgcg
ttcaacttccctgtggcggtgtacggctggaacaacgccatcgccatgatctgtgggaat
gcctgcctttggaaaggagctccaacaacttccctcattagtgtagccgttacaaagata
atagccaaggttctggaggacaacgagctgcctggtgcgatttgttccttgacttgtggt
ggagcagatatcggcacagcaatggccaaagatgagcgggtgaacctgctgtccttcacc
gggagcacccaggtgggaaaacaggtggcccttatggttcaggagaggtttgggagaagt
ttgttagaacttggaggaaacaatgccatcatagcttttgaggatgcggacctcagctta
gtcgttccctcagctctgtttgcggccgtggggacagccggccagaggtgtaccactgcg
aggcgcctgtttttacaagaaagcatccatgatgaagttgttaatagacttaaaaaggcc
tacgcacagatccgtgtcgggaacccatgggactctaatgttctctatgggccgctccac
accaaacaggcagtgagcatgtttcttggagcagtggaggaagcaaagaaagaaggtggc
acagtggtctatggtggcaaggttatggaccgccctggaaactatgtagagccaacaatt
gtgacaggtcttgaccacagtgcgcccattgcacacacagagacttttgccccgattctt
tatgtgtttaaattcaagaatgaagatgaggtctttgtgtggaataatgaagtcaaacag
ggactttcaagtagcatctttaccaaggatttgggcagaatcttccgctggcttggacca
aaaggatcagactgtggcattgtaaacgtcaacattccaacaagtggggctgagattgga
ggtgcatttggaggagaaaagcacactggcggtggcagggagtccggtagtgatgcctgg
aaacagtacatgagaagatctacttgtaccatcaactacagtaaggaccttcccctggcc
caaggaatcaagtttcagtaa

DBGET integrated database retrieval system