KEGG   Camelus dromedarius (Arabian camel): 105089810
Entry
105089810         CDS       T04642                                 

Gene name
ACOX2
Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 2 isoform X1
  KO
K10214  3alpha,7alpha,12alpha-trihydroxy-5beta-cholestanoyl-CoA 24-hydroxylase [EC:1.17.99.3]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00120  Primary bile acid biosynthesis
cdk01100  Metabolic pathways
cdk03320  PPAR signaling pathway
cdk04146  Peroxisome
Module
cdk_M00862  beta-Oxidation, peroxisome, tri/dihydroxycholestanoyl-CoA => choloyl/chenodeoxycholoyl-CoA
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    105089810 (ACOX2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105089810 (ACOX2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105089810 (ACOX2)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.99  With unknown physiological acceptors
    1.17.99.3  3alpha,7alpha,12alpha-trihydroxy-5beta-cholestanoyl-CoA 24-hydroxylase
     105089810 (ACOX2)
SSDB
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Other DBs
NCBI-GeneID: 105089810
NCBI-ProteinID: XP_010979236
LinkDB
Position
17
AA seq 719 aa
MPPANWDLRTPKKQSCPPLNQHTASGEGHSNTRQIQATMGSPVHRVSLGDTWSKQVHPDI
QSERHMQSFDVEQLTKILDGGAQNTALRRKVESIIHSDPVFSLKDNYFMTQNEHYEAALK
KKFHIQMLAQRLGWSEDSRELGYAYRSLSGDLALGVHNIFLKSIRSLGSEEQIAKWAPLC
NKFQIIGTYAQTELGHGTYLQGLETEATYDAATQEFVVHSPTTTAIKWWPGGLGWSATHA
LVQAQLICSGARQGMHAFIVPIRSLQDHSALPGITVGDIGPKMEFDHMDNGFLQLDHVRI
PRENMLSRFAQVLPDGTYIKLGTAKANYLTMVVTRVDILLGEVIPMLEKACVIAIRYSVV
RRQFRIRPSDPEAKILDYQTQQQKLLPQLATAYAFHFQASSLLEFFHRSYSSILDKDFSL
LPELHALSAGAKAMVTDFCAQGAELCRRACGGHGYSKLSGLPSLVTRVAASCTYEGENTV
LYLQTARFLVKIYLQAQESPGSTSQRSLPQSVAYLTAPDQTRCPAQRAADFLHPEHYTMA
WAHVATRLIKDSAHHLQTLMKSGADWHEAWNQTTVIHLQAAKAHCYYVTVKTFTEALEKL
ESEPAIQQVLKRLCDLYALHGILTNTGDFLYDGFLSGAQIDVARTAYLDLLILIRKDAIL
LTDAFDFTDQCLNSALGCYDGNVYERLFHWAQKAPTNTQGNPAYEKYLRPLLQRWRSRL
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgcctcctgcaaactgggatcttaggaccccaaaaaagcagagctgccctcccctcaac
caacacactgcctcaggagagggacattccaacaccaggcagatccaggctacaatgggc
agtccagtgcaccgagtgtcactgggggacacctggagcaagcaagtgcaccctgacata
cagagcgagaggcacatgcagtcctttgacgtggaacagctcaccaaaatccttgacgga
ggtgcccagaacactgcacttcgcaggaaagttgaaagcatcatccacagtgacccagtg
tttagcctgaaggataattatttcatgacccagaatgaacactacgaagccgccttaaag
aagaaattccacattcagatgttagcacagcgcctgggctggtcggaagacagtcgtgag
ttaggatacgcttacagaagcctttctggagatctggccttaggtgtacacaacatcttc
ctgaaatccatcaggagcctgggctcagaggagcagattgccaagtgggccccactctgc
aacaagttccagatcattggaacatatgcccagacagaactggggcacgggacatatctt
cagggcctggagactgaagccacctacgatgcagctacccaggagtttgtggtgcacagt
cccacgacgacggccatcaaatggtggcccggtggcctgggatggtcagccacccatgcc
ctggtccaggcccagctgatctgctcaggagcccggcagggcatgcatgcctttatagtg
cccatccggagcctccaggaccacagcgcactgccaggaatcaccgttggagacattggg
cccaagatggaatttgaccacatggataatggcttcttgcaactggaccacgtgcggatc
cccagggagaacatgctgagtcgctttgcacaggtcttgccagacggcacctacatcaag
cttggaacagcaaaggccaactacctcaccatggtggtgacgcgggtggacatactgttg
ggcgaggtcataccgatgctagaaaaggcttgcgtcattgccatccgctactcggttgta
cgccgccaattccggatccggcccagcgacccggaggctaaaatcctggactaccagacg
cagcagcagaagctcctccctcagctggccacggcctatgcgttccacttccaggcgagc
agcctcctggagttcttccatcgctcctacagctccattttggacaaagacttcagcctc
ctgcctgagcttcacgcactgagcgcaggtgccaaggccatggtgacggacttctgcgcc
cagggggcggagctgtgccgcagggcctgcggtggacacggctactcgaagctgagcggc
ctgccctccctggtcaccagggtggcagcctcctgcacctacgagggtgagaacactgtg
ctctacctgcagacggccaggtttctggtgaagatctacctgcaggctcaggagtcccca
ggctccacatctcagaggtctctccctcagtctgttgcatacctgactgcacctgaccag
accaggtgcccagcccaaagggctgccgacttcctccacccagagcactacaccatggcc
tgggcacacgtggcaaccaggctcataaaggactcagcgcatcatttacagactctgatg
aaatctggggcggactggcacgaggcatggaaccagaccactgtcatacatctccaggct
gccaaggcacactgctactatgtcactgtgaagacttttacagaagctctggagaaacta
gaaagtgaaccagcaattcagcaggtgctcaaacgcctctgtgatctctatgctttacat
ggcatcctgactaacacgggcgactttctctatgatggcttcctatctggtgcccaaata
gatgtggcaagaacagcctatctggacctgctcatcctcatccggaaggatgctatcttg
ttaactgatgcttttgacttcaccgatcagtgtttaaattcagcacttggctgttacgat
ggaaatgtctatgaacgtctgttccactgggctcagaaggcaccaaccaatacccagggg
aacccggcctatgagaaatatctaagaccactattacagagatggagatccaggctatga

KEGG   Camelus dromedarius (Arabian camel): 105103342
Entry
105103342         CDS       T04642                                 

Gene name
ACOX3
Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 3 isoform X1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00071  Fatty acid degradation
cdk00410  beta-Alanine metabolism
cdk00592  alpha-Linolenic acid metabolism
cdk00640  Propanoate metabolism
cdk01040  Biosynthesis of unsaturated fatty acids
cdk01100  Metabolic pathways
cdk01200  Carbon metabolism
cdk01212  Fatty acid metabolism
cdk03320  PPAR signaling pathway
cdk04024  cAMP signaling pathway
cdk04146  Peroxisome
Module
cdk_M00087  beta-Oxidation
cdk_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    105103342 (ACOX3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105103342 (ACOX3)
   00592 alpha-Linolenic acid metabolism
    105103342 (ACOX3)
   01040 Biosynthesis of unsaturated fatty acids
    105103342 (ACOX3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105103342 (ACOX3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    105103342 (ACOX3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105103342 (ACOX3)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105103342 (ACOX3)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     105103342 (ACOX3)
SSDB
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_ox_N Acyl-CoA_dh_2
Other DBs
NCBI-GeneID: 105103342
NCBI-ProteinID: XP_031294094
LinkDB
Position
2
AA seq 700 aa
MAPPEEGSDVLVLPDPPRGPLHAARARASFCWKELALFLEGEDVLRFKNAVFSALESDPL
FAHPRGSDLSVEKYQELNFLRCKRIFEYDFLPMEDVLGSPWRIRVLVECLGMYDWSLATK
FFLHLLTFGSTIYSSGSERHFKYIPKIFSLEIFGCFALTELSHGSNTKAIRTTAHYDPTT
EEFILHSPDFEAAKFWVGNMGKTATHTVLFAQLYTPGGQCHGLHPFVVQIRDPKTLLPMP
GVMVGNIGKKLGQNGLDNGFALFHKVRIPRQDLLNRTGDVTPEGAYVSSFKDVRQRFGAS
LGSLSAGRVSIVGMAVTNLKLAMSIALRFSATRRQFGPTGEEEVPVLEYQMQQWRLLPYL
AATYALDHFSKSLFLDMEKLQHGLLGNDQSATQAELGREIHALASAGKSLASWTAQRGIQ
ECREACGGHGYLAVNRLGELRNDNDPNCTYEGDNNVLLQQTSNYLLSLLERRGPGGPRVE
SPLKTVDFLESYPDILGRRFTGPSPEDCWDSSAALAAYEWLVCYLLQESYQKLNREKQSG
SSDFEARNNCQVYHCRSLALAFLEFTVARRFHEHTHQPHVPPPLRAVLWRLSALYTLWSL
SQHTALLYRGGYFSGEQAGKVIENTILALCAQLKDDAVALVDVIAPPDFILDSPIGRADG
ELYKNLWTAVLQGSRVLERASWWPEFSANKPVVGSLKSKL
NT seq 2103 nt   +upstreamnt  +downstreamnt
atggcgccccccgaggaagggagcgatgtcctggtgctgccagacccgccccggggaccc
ctgcacgcggcccgtgcccgcgcctccttctgctggaaggagctggcgctgttcttggag
ggcgaggatgtgctgcgctttaagaatgctgtcttctcggctctggagagcgaccccctc
ttcgcgcatccccgtggaagtgatctctcagtggagaagtaccaggagctgaacttcctg
cgctgcaagcggatcttcgaatatgacttcctccccatggaggacgtgctgggaagcccc
tggaggatccgggtgctggttgagtgcctcggcatgtacgactggtccctggccaccaaa
ttcttcctgcacctcctgacttttggatccacgatttacagctctggttctgaaaggcat
ttcaaatatatcccaaagatcttcagtttggagattttcggctgttttgctctgaccgaa
ttgagtcacgggagtaacaccaaggccatccggacgactgctcactacgaccctactact
gaggagttcatcctacactcccctgatttcgaagctgccaagttctgggtcggcaacatg
ggcaagaccgctacgcacactgtgctcttcgctcagctgtacacaccggggggccagtgc
cacgggctgcacccctttgtcgtgcagattcgagacccaaagacccttcttcccatgcca
ggggtgatggttggcaacattgggaagaagctcgggcagaacggtctggacaacgggttt
gccctgttccacaaggtgagaattcctcgccaggacctgctgaaccgcacgggcgacgtc
acccctgagggtgcctacgtctcctcctttaaggacgtcaggcagcgcttcggagcatct
ctgggcagcctgtccgcaggccgggtctccattgtgggtatggccgtcaccaacttaaag
ctggccatgtccatagcactgcggttctcagccaccaggcgccagtttggaccgacaggc
gaggaggaggtaccggtgctggagtatcagatgcagcaatggcgcttactcccgtacctg
gcggccacctacgccttggaccacttttccaagtcgctcttcctggacatggagaagctt
cagcacggcctcctggggaacgaccagagtgccacgcaggcagagctcggacgtgagatc
catgccttggcatcggctggcaagtccctggcctcgtggactgcccagcggggaattcag
gaatgccgggaggcgtgtggcggacacggctatctggccgtgaaccgtctgggcgagctc
aggaacgacaacgaccccaactgcacatacgagggagacaacaacgtgctgctgcagcag
accagcaactacctgctcagcctgctagagcgccgcggcccaggtggccctcgcgttgag
agccctctgaagactgtggactttctggaatcctatcccgacatccttggccggaggttc
acaggccccagccctgaggactgctgggactcctcagccgccctggcagcgtacgagtgg
ctggtttgctatctgctccaggagagttaccagaagttaaatcgagagaagcagtctggg
agcagcgactttgaagcaagaaacaactgtcaggtgtaccactgccgctccttggccctg
gccttcctggagttcacggtggcgcggaggttccacgagcacacgcaccagccccacgtg
ccgcctccgctgcgggccgtgctctggcggctgagcgccctctacaccctgtggtccctg
agccagcacacagccctgctctaccgaggtggctacttttctggtgagcaagcaggtaaa
gtgatagagaacaccatcctggccctgtgcgcccagctgaaagatgatgctgttgccctg
gtggacgtgatcgcccctccggacttcatcctggactccccgattggcagagccgacggc
gagctctataaaaacctctggaccgcagtccttcagggaagcagggtgctggagagagcg
tcgtggtggccggaattctctgccaacaagcccgtcgtaggaagtttgaaatcaaagctg
tag

KEGG   Camelus dromedarius (Arabian camel): 105105527
Entry
105105527         CDS       T04642                                 

Gene name
ACOX1
Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1 isoform X2
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00071  Fatty acid degradation
cdk00410  beta-Alanine metabolism
cdk00592  alpha-Linolenic acid metabolism
cdk00640  Propanoate metabolism
cdk01040  Biosynthesis of unsaturated fatty acids
cdk01100  Metabolic pathways
cdk01200  Carbon metabolism
cdk01212  Fatty acid metabolism
cdk03320  PPAR signaling pathway
cdk04024  cAMP signaling pathway
cdk04146  Peroxisome
Module
cdk_M00087  beta-Oxidation
cdk_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    105105527 (ACOX1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105105527 (ACOX1)
   00592 alpha-Linolenic acid metabolism
    105105527 (ACOX1)
   01040 Biosynthesis of unsaturated fatty acids
    105105527 (ACOX1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105105527 (ACOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    105105527 (ACOX1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105105527 (ACOX1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105105527 (ACOX1)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     105105527 (ACOX1)
SSDB
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Other DBs
NCBI-GeneID: 105105527
NCBI-ProteinID: XP_010997624
LinkDB
Position
16
AA seq 661 aa
MNQDLRKERAAASFNPELLTHVLDGSPENTRRRREIENLILKDPDFQHEDLNFLTRSQRY
EVAVRKSATTVEKMRKFGIADPDEIMWFKNFVQRGQPGPLDLHLGMFLPTLLHQATEEQQ
ERFFMPAWNLEIIGTYAQTEMGHGTHLRGLETTATYDPETQEFILNSPTVTSIKWWPGGL
GKTSNYAIVLAQLITQGKCYGLHAFIVPIRELGTHKPLPGITVGDIGPKFGYDEMDNGYL
KMDNYRIPRENMLMKYAQVKPDGTYVKPVSNKLTYGTMVFIRSFLVGEAARCLSKACTIA
IRYSAVRHQSEIKPGEPEPQILDYQTQQYKLFPLLATAYAFQFVGAYMKETYHRINKDIG
QGDLSELPELHALTAGLKAFTSWTANAAIEACRMACGGHGYSHCSGLPNIYVNFTPTCTF
EGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTVVDINSP
DSLTEAYRLRAARLVEIAAKNLQAEVIHRKSKEVAWNLTSIDLVRASEAHCHYVVVKLFS
EKIPQIQEKSVQAVLRNLCLLYSLYGICQKAGDFLQWGIMTESQVTQVNERIKELLTAIR
PDAVALVDAFDFQDVTLGSVLGRYDGNVYENMFEWAKKSPLNKTEVHESYHKHLKSLQSK
L
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgaaccaggacctgcggaaggagcgggccgccgccagcttcaacccggagctgctcacg
cacgtcctggacggcagccccgagaacacccggcgccgccgagagattgagaacttgatt
ctgaaagacccagacttccagcatgaagacttgaacttcctcactcgtagccagcgttat
gaagtggctgttaggaagagcgccaccacggtggagaagatgaggaagtttggcatcgca
gaccctgatgaaatcatgtggtttaaaaactttgtgcagcgagggcagcctgggcctctg
gatcttcacttgggcatgttcctgcccaccttgcttcaccaggcgaccgaggagcagcag
gagcgcttcttcatgcccgcctggaacttggagatcattggcacttatgcccagacagag
atgggtcatggaactcaccttcgaggcttggaaaccacagccacttacgaccctgaaacc
caggagtttattctcaatagtcctactgtgacctccatcaagtggtggcctggtgggctt
ggaaagacgtcaaactatgcaattgtacttgcccagctcatcactcaggggaaatgctac
gggttacatgccttcattgttcctattcgggaacttgggacccataagcctctgccaggg
attaccgttggagacatcggccccaaatttggctatgatgagatggataacggctacctg
aagatggacaattaccgtattcccagagaaaacatgctgatgaagtacgcccaggtgaag
cctgatggcacgtacgtgaaacccgtgagtaacaagctgacctacgggaccatggtgttc
atcaggtccttccttgtgggagaagccgctcggtgtctgtctaaggcatgcaccattgcc
atccgatacagtgccgtgaggcaccagtctgaaatcaagccaggtgaaccagaaccacag
attttggattatcaaacccagcagtacaaactttttcccctcctggccaccgcctatgcc
ttccagtttgtgggcgcatacatgaaggagacctatcaccggattaacaaggacattggc
cagggggacctgagtgagctgccagagcttcatgccctcaccgccgggctgaaggccttc
acgtcctggacggcgaacgctgctatcgaagcctgtcggatggcctgtggggggcatggc
tattctcactgcagtggacttccaaatatttatgtcaattttaccccaacctgcaccttt
gagggagaaaacactgtcatgatgctccagacagccaggttcctgatgaaaagttacgac
caggtacactcaggaaagttggtgtgtggcatggtgtcctacttgaatgacctgcccagt
cagcgcatccagccacagcaggtggcagtctggccgaccgtggtggacatcaacagccct
gacagcctaactgaagcgtacagactccgtgcagccagattagtagaaattgctgcgaaa
aaccttcaagctgaagtcattcacagaaaaagcaaggaggtagcatggaacctaacgtcc
attgacctggttcgggcaagtgaggcacattgccactatgtggtagttaagctcttttca
gaaaaaatcccccaaattcaagagaaatccgtccaagctgtcttaaggaatttgtgtctc
ttgtattccctgtatggaatctgtcagaaggcaggggattttcttcagtggggcatcatg
acagagtctcaagtcacccaagtgaacgagcgcataaaggagctgctgactgccatccgc
cctgatgctgttgctctggttgacgcatttgatttccaggatgtgacactgggctctgtg
cttggccgctatgatggcaacgtgtatgaaaacatgttcgagtgggccaagaagtcccca
ctgaacaaaacagaggtccatgaatcttaccacaagcacctgaagtcactgcagtccaag
ctctga

DBGET integrated database retrieval system