KEGG   Camelus dromedarius (Arabian camel): 105089905
Entry
105089905         CDS       T04642                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk04010  MAPK signaling pathway
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04020  Calcium signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04068  FoxO signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04510  Focal adhesion
cdk04540  Gap junction
cdk04630  JAK-STAT signaling pathway
cdk04810  Regulation of actin cytoskeleton
cdk05160  Hepatitis C
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05210  Colorectal cancer
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05219  Bladder cancer
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05226  Gastric cancer
cdk05231  Choline metabolism in cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105089905 (EGF)
   04012 ErbB signaling pathway
    105089905 (EGF)
   04014 Ras signaling pathway
    105089905 (EGF)
   04015 Rap1 signaling pathway
    105089905 (EGF)
   04630 JAK-STAT signaling pathway
    105089905 (EGF)
   04066 HIF-1 signaling pathway
    105089905 (EGF)
   04068 FoxO signaling pathway
    105089905 (EGF)
   04020 Calcium signaling pathway
    105089905 (EGF)
   04072 Phospholipase D signaling pathway
    105089905 (EGF)
   04151 PI3K-Akt signaling pathway
    105089905 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105089905 (EGF)
   04540 Gap junction
    105089905 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105089905 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105089905 (EGF)
   05231 Choline metabolism in cancer
    105089905 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105089905 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105089905 (EGF)
   05212 Pancreatic cancer
    105089905 (EGF)
   05226 Gastric cancer
    105089905 (EGF)
   05214 Glioma
    105089905 (EGF)
   05218 Melanoma
    105089905 (EGF)
   05219 Bladder cancer
    105089905 (EGF)
   05215 Prostate cancer
    105089905 (EGF)
   05213 Endometrial cancer
    105089905 (EGF)
   05224 Breast cancer
    105089905 (EGF)
   05223 Non-small cell lung cancer
    105089905 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    105089905 (EGF)
   05165 Human papillomavirus infection
    105089905 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105089905 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cdk04052]
    105089905 (EGF)
Cytokines and growth factors [BR:cdk04052]
 Growth factors
  Growth factors (RTK binding)
   105089905 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA DUF5050 EGF EGF_3 Tr-sialidase_C MMPL
Other DBs
NCBI-GeneID: 105089905
NCBI-ProteinID: XP_010979387
LinkDB
Position
2
AA seq 1173 aa
MLLFLIILLPVVFKFSFVSPLALQRWNCPEGFPSGDGNSDRVGPAPFLIFSHGSSVFRID
LEGTNHKQLVADAGISVIMDFHYNEERIYWVDLERQLLQRVLLNGTRQEKVCHIEKNVSG
LAINWINEELIWSNQQEGIITVTDMKGNNSRVLLSALKYPANVAVDPVERFMFWSSEVAG
SLHRADLSGVEVKLLLETSEKIAAVSLDVLDKRLFWIQNNREGSDSRIWSCDYDGGSVHF
SKHLTQHNLFAMSLFGDRIFYSSWKKKAIWIANKHTGKDMVKINLNLSFVPPGGIKVVHP
LVQPQARSAASASDQKLCKLQKGNCRGSMCGQEPKSRLCTCAEGYALSQDGKNCEDVNEC
AFWNHGCTLGCENIPGSYHCTCPVGFVLLSDGKRCHQLISCPNNVSECSHDCVLTSDGPI
CFCPEGSVLETDGKTCTGCSSPDNGGCSQLCIPLSPVSWECGCFPGYDLQLDKKSCTASG
PEPFLLFANSQDIRHMRFDGTDYGTLLSQQMGTVFALDHDPVENKVYFAHTALKWIERAN
MDGSQRERLIEEAIDTPEGLAVDWIGRKFYWTDRRKSLIQGSDLNGKYREVIIKEDISQP
RGIAVHPMAKRLFWTDMGINPRIESSSLQGIGRLIIVNSDLIWPSGITIDYLTDKLYWCD
AKQSVIEMANLDGSERQRLAQNDVGHPFAVAVFEDHVWFSDWTMPSVIRVNKRTGKNRVR
LRGSMLKPSSLVVVHPLAKPGADPCLHQNGGCEHICKERFGIARCLCREGFVKAPDGKAC
LALNGHQILAGSGPDLSNQVTPLDILPRSREFEDNSTGSQQMLVAEIMVSDDDDCGAMGC
SPQAQCVSEGEDATCQCLKGFAGDGRLCSDIDECEMGISVCPPRSSTCINTEGGHVCRCS
EGYQGDGIHCLDSTPVSYLREDGPYSVRSVYRKCPPSYHGYCLNGGVCTYLELINHSACT
CVVGFFGERCQSQDFTWWDLRHADHGQQQSITVVAVCVVALVLLLLLGLWGAHYYRSQKL
LSKTPKNPYEESSRGVSGIGPADGETGMSSCPQPWFVVIKEHQNLRNGSQPLALEDGLVA
DVGQFSSLEPGPLQSPPWRKEPQMYMGAEQGCCIPSSGDKGSGLQGMKCSFHLPSCGVRP
IAVGLEKSHSLLSANPLRQQRAPDPPHQMEVTQ
NT seq 3522 nt   +upstreamnt  +downstreamnt
atgctgcttttccttatcattctgttgccagtagtttttaagtttagttttgttagcccc
ttagcactgcagcgctggaactgtcctgaaggctttccctcaggagatgggaattctgat
cgtgtgggtcctgcgccctttttaattttctctcatggaagcagtgtctttcggattgac
ttggaaggaacaaatcataagcaattagtggcagatgctggcatatcagtgatcatggat
tttcattacaatgaagaaagaatctattgggtcgatctagaaagacaacttttgcaaaga
gttttgctgaatgggacaaggcaagagaaagtatgccatatagagaaaaatgtttcagga
ctggcaataaattggatcaatgaagaacttatttggtcaaatcaacaggaaggaatcatt
acagtaacagatatgaaaggaaacaattcccgtgttctcttaagcgccttaaaatatcct
gcaaatgtagcagttgatccagtagaaaggtttatgttttggtcctcagaggtggctggc
agccttcacagagcagacctcagcggtgtggaagtgaagcttctgttagagacgtcagag
aaaattgcagctgtgtcattggatgtgcttgataaacggctcttttggattcagaacaat
agagaaggaagtgattctcgtatttggtcctgtgattatgatgggggttctgtacatttt
agcaaacatctcacacagcacaatttgtttgcaatgtccctttttggtgatcgtatcttc
tattcatcatggaaaaagaaggcaatttggatagctaacaagcacactggcaaggatatg
gttaaaattaacctcaatctatcatttgtaccacctggtggaattaaagtagtgcatcca
ctcgtccagccccaggcaagaagtgctgcttcggcctctgatcagaaactctgcaaactg
cagaaaggaaactgtagaggcagcatgtgtgggcaagagcctaagtcccgtttgtgcacg
tgtgcagagggatacgctttaagtcaagatggaaagaactgtgaagatgtcaacgagtgt
gccttttggaatcacggctgtactcttggatgtgaaaacatccctggatcctatcactgt
acatgccctgtaggatttgttctgctttctgatgggaaacggtgtcaccaactaatttcc
tgcccaaacaatgtatctgaatgcagccatgactgtgttctgacatcagatggtcccata
tgtttctgtcctgaaggctcagtgcttgagacagatggaaaaacatgtactggctgttca
tcacctgataatggtggatgtagccagctctgcatccctctcagcccagtatcctgggag
tgtggttgctttcctggatatgacctacagctggacaaaaagagctgtacagcgtcagga
ccagagccttttttgctttttgccaattctcaagatattcgacacatgcgtttcgatgga
acagattatggaaccctgctcagccagcaaatgggaacggtttttgccctagatcatgac
cctgtggaaaataaggtgtactttgcccatacagccctgaagtggatagagagagctaat
atggatggttcccagcgagaaaggcttattgaagaagcaatagatacgccagaaggtctt
gctgttgactggattggccgtaaattctattggacagacagaaggaaatctctcattcaa
gggagtgatttaaatggaaaataccgtgaagtaatcattaaagaggatatctctcagcca
cgaggaattgctgttcatccaatggccaagagattattctggactgatatggggattaat
ccacgaattgaaagttcttcccttcaaggcattggccgactgattatagttaactcagat
ctgatctggcccagtggaataacgattgattacctaactgacaagttgtactggtgtgat
gccaagcagtctgtgattgaaatggccaatctggatggttcagaacgccaaagacttgcc
cagaacgatgtaggtcacccatttgctgtggctgtgtttgaggatcatgtgtggttctcc
gattggactatgccatcggtaataagggtgaacaagaggactggcaaaaacagggtacgt
ctccgaggcagcatgctgaagccctcatcactggttgtagttcatccattggcaaaacca
ggagcagatccctgtttgcatcaaaatggaggctgtgaacatatttgcaaagagaggttt
ggaattgctcggtgtttgtgtcgtgaaggttttgtgaaagccccggatggaaaagcatgt
ctggctctgaatggccatcagatattggcaggtagtggaccagatctgagtaatcaagta
acgccattggacatcttacccaggagtagggagtttgaagataacagtacaggatctcaa
cagatgctagtggctgaaatcatggtgtcagatgacgatgactgtggtgccatgggatgc
agtccacaggctcagtgtgtttcagagggagaggatgccacgtgtcagtgtttgaaagga
tttgctggagatggaagactatgttctgatatagatgaatgtgagatgggtatctcagtt
tgccctccccgctcctccacgtgcatcaatactgaaggtggccacgtctgccgatgctca
gaaggctaccaaggagatgggattcactgtcttgactctactccggtgtcttacctcagg
gaggatggcccctattctgtgagaagtgtgtaccgcaaatgtccgccatcctatcatggg
tactgtctcaacggtggtgtgtgtacttatcttgaactaatcaaccactctgcctgcacc
tgtgttgttggcttcttcggggagcgatgtcagtctcaagactttacatggtgggatctg
cgccacgctgaccacgggcagcagcagagcatcaccgtggtggctgtctgtgtggtggca
ctggtcctgctgctgctcctggggctgtggggggctcactactacaggtctcagaagctg
ctatcgaaaactccaaagaatccttatgaagagtccagcagaggtgtgagtggtatcggg
cctgctgatggcgagactgggatgtcctcttgtccccaaccttggtttgtggttataaag
gaacatcaaaacctcaggaatggaagtcaacctctagccctcgaggatggcctggtagca
gatgttggccagttttcttctctggagcctgggccactgcagtcaccaccgtggaggaag
gagccccagatgtatatgggcgcagaacaaggatgctgcatcccttcatctggtgacaaa
ggctctggtctccaggggatgaagtgtagctttcatctaccctcctgtggggtacgaccc
attgctgtggggcttgagaagtcccattctctcctgtcagctaacccattaaggcagcaa
agagccccagatccaccacaccaaatggaggtgactcagtga

DBGET integrated database retrieval system