KEGG   Camelus dromedarius (Arabian camel): 105089907Help
Entry
105089907         CDS       T04642                                 

Gene name
ENPEP
Definition
(RefSeq) glutamyl aminopeptidase
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    105089907 (ENPEP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cdk01002]
    105089907 (ENPEP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105089907 (ENPEP)
   04090 CD molecules [BR:cdk04090]
    105089907 (ENPEP)
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     105089907 (ENPEP)
Peptidases and inhibitors [BR:cdk01002]
 Metallo peptidases
  Family M1
   105089907 (ENPEP)
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105089907 (ENPEP)
CD molecules [BR:cdk04090]
 Proteins
  105089907 (ENPEP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF1570
Motif
Other DBs
NCBI-GeneID: 105089907
NCBI-ProteinID: XP_010979392
LinkDB All DBs
Position
2
AA seq 949 aa AA seqDB search
MNFEEGESSKRYCIKTKHVAIICAVVVAVGLIVGLSVGLTRSCDSTDRGQGTTQPPSHLP
STPSPPQDQEEVCPASEDESGGWKDFRLPDFINPVHYDLEVKPLLEEDKYTGSVHISINV
SSPTQHLWLHIRETRITQLPVLRRHSGEQVQVRRCFEYKKQEYVVVEAEGELAPSSAEGL
YHLTMEFAGSLNGSLVGFYRTTYVEKGQVKSIAATDHEPTDARKSFPCFDEPNKKATYTV
SIIHLKEYKALSNMPVEKEESVDDKWNRTTFQKSVPMSTYLVCFAVHQFDSVTRMSKRGI
PLTIYVQPEQKHTAEYAANITKSVFDYFEDYFAMEYSLPKLDKIAIPDFGTGAMENWGLI
TYRETNLLYDPEESASSNQQRVATVVAHELVHQWFGNIVTMEWWDDLWLNEGFASFFEFL
GVEHAEKEWQMRDQMLLEDVLPVQEDDSLISSHPVVVTVSTPAEITSVFDGISYSKGASI
LRMLEDWITPEKFQKGCQNYLKKHEFKNARTSDFWEALEEASNLPVKEVMDTWTNQMGYP
VLNVENTRTITQKRFLLDSKANASEPYSVFGYTWNIPVKWTEDNASRTTFYNRSETGGIA
LNSPNPSGNAFLKINPDHIGFYRVNYEVPTWERIAINLSNNHQEFSSADRAGLIDDAFAL
ARAQLLNYKEALNLTKYLKMEEDFLPWERVISSVTYIISMFEDDTEIYPMIEKYFRDQVK
PTADSLGWDDTGDHITKLLRASVLGLACKMGDSDALNNASQLFQKWLTGTLSLPVNLRLL
VYRYGMQNSGNETSWNYTLEQYEKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLKDSNLI
KTQDVFTVIRYISYNSYGKTMAWNWIQLNWEYLVNRYTINDRNLGRIVTIAEPFNTELQL
WQIKSFFERYPEAGAGEKPREQVLETVKNNIEWLKQNRDTIRDWFFDLS
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaagagggagaaagctctaagagatactgcattaaaacaaaacatgtggcc
atcatctgtgcagtggtggtggctgtcggattaatagtagggctttccgtgggcttgacc
agatcgtgtgactctaccgacagaggacagggcacaacccaacctccttcccaccttcct
tccactccgagccctccacaggaccaggaggaggtctgccctgccagtgaagatgaaagt
ggaggctggaaagatttcaggctgccagacttcatcaatccagtgcactacgacctggag
gtgaagcccctgttggaggaggacaagtacacgggcagcgtgcatatctccatcaatgtg
agctcgcccacccagcacctatggctgcatatccgggagacaaggatcacccagctccca
gtgctgaggaggcactctggggagcaagtccaagtccggcggtgctttgaatacaaaaag
caggagtatgtggtggtggaggcagaaggagagcttgcacccagcagtgccgagggtctc
taccatctgacaatggagttcgctggctcgctgaacggctcgctcgtggggttttataga
acgacatacgtggagaaaggacaagtcaagagcatagcagccactgatcatgaaccaaca
gatgccaggaaatcctttccttgttttgatgagcccaacaaaaaggcaacttacacagtg
tctatcatccacctcaaagagtataaggcactttcaaatatgccagtggagaaagaagag
tcggtggatgataaatggaatcgaacaactttccagaagtctgtccccatgagcacttac
ttggtgtgctttgctgtacatcagtttgactccgtaacaagaatgtcaaaaaggggaata
cctctcactatatatgtccagccagagcaaaaacacacagctgaatatgctgcaaatata
actaaaagtgtgtttgattattttgaagactactttgctatggaatattctcttcctaaa
ttagataaaatcgctattccagattttggcactggggctatggagaactggggactcatc
acatacagagaaacgaacctgctctatgaccctgaggaatcagcctcatcaaaccaacag
agggtggccactgtggttgcccatgaacttgtgcatcagtggtttggaaatattgtgacc
atggaatggtgggacgacttgtggctaaatgaaggatttgcttccttctttgagttcctg
ggagtagaacatgcagaaaaagagtggcaaatgcgtgaccagatgttacttgaagatgta
ttacctgtacaagaggatgactctttgatatcttcacacccagttgttgtcactgtgtca
actcctgctgaaatcacatctgtttttgatgggatttcttatagcaagggagcttccatt
ctgagaatgcttgaagactggataacaccagagaaatttcagaaaggatgtcagaattat
ttgaaaaaacatgaatttaagaatgcaagaacttcagatttttgggaagcacttgaagag
gcaagtaacctaccagtgaaagaagtaatggacacctggaccaatcagatgggttatcct
gtacttaatgtggaaaacacgaggactatcacacagaaacgctttctgttggactcaaaa
gccaatgcttccgagccatattcagtttttggttacacatggaatattccagttaaatgg
actgaagataatgcatcaaggactacattctataataggtcagaaacaggaggaatcgct
ttgaactctcctaatcctagtggaaacgcttttctcaaaataaacccagatcatattggg
ttttatcgtgtaaattatgaagtaccaacttgggaacggatagctatcaatctttccaac
aaccaccaggaattttcttctgctgatcgtgcaggtcttattgatgatgcttttgccttg
gcaagagctcaacttctaaattataaggaggctctgaacttgaccaagtatctcaaaatg
gaagaagactttttaccatgggagcgagtcatttcatctgtaacctatatcattagcatg
tttgaagatgatacagagatataccctatgattgagaaatacttccgagatcaagtgaag
cccactgcagattctctgggatgggatgacactggagaccatatcacaaagttactccgt
gcctctgtgttagggcttgcatgcaagatgggagacagtgatgccttgaacaatgcttcc
cagttatttcagaagtggctaactgggactttaagtcttcctgtaaacctcaggcttctg
gtatatcggtatggaatgcagaactctggcaatgagacttcatggaactacactcttgag
caatacgagaaaacttcattagctcaagaaaaagaaaagctactatatggattagcatcc
gtgaagaatgttactcttttgtcaaggtatttggatttgctcaaggactcaaatcttatt
aaaactcaggatgtgtttacagtcattcgatatatctcatacaacagctatgggaagact
atggcttggaattggatacagctcaactgggaatatctagtcaacagatatacaatcaat
gacagaaaccttggccggattgtcacgatagcagagccattcaacactgaactacagctc
tggcagataaagagctttttcgaaagatatccagaagctggagcaggagaaaaacctagg
gagcaagtgctggaaacagtgaaaaacaatatcgagtggctaaagcaaaacagagacacc
ataagagattggttttttgatttatcttga

DBGET integrated database retrieval system