KEGG   Camelus dromedarius (Arabian camel): 105090136
Entry
105090136         CDS       T04642                                 

Gene name
IL4
Definition
(RefSeq) interleukin 4 precursor
  KO
K05430  interleukin 4
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04060  Cytokine-cytokine receptor interaction
cdk04151  PI3K-Akt signaling pathway
cdk04630  JAK-STAT signaling pathway
cdk04640  Hematopoietic cell lineage
cdk04657  IL-17 signaling pathway
cdk04658  Th1 and Th2 cell differentiation
cdk04659  Th17 cell differentiation
cdk04660  T cell receptor signaling pathway
cdk04664  Fc epsilon RI signaling pathway
cdk04672  Intestinal immune network for IgA production
cdk05140  Leishmaniasis
cdk05200  Pathways in cancer
cdk05310  Asthma
cdk05320  Autoimmune thyroid disease
cdk05321  Inflammatory bowel disease
cdk05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    105090136 (IL4)
   04151 PI3K-Akt signaling pathway
    105090136 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105090136 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    105090136 (IL4)
   04660 T cell receptor signaling pathway
    105090136 (IL4)
   04658 Th1 and Th2 cell differentiation
    105090136 (IL4)
   04659 Th17 cell differentiation
    105090136 (IL4)
   04657 IL-17 signaling pathway
    105090136 (IL4)
   04664 Fc epsilon RI signaling pathway
    105090136 (IL4)
   04672 Intestinal immune network for IgA production
    105090136 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105090136 (IL4)
  09163 Immune disease
   05310 Asthma
    105090136 (IL4)
   05320 Autoimmune thyroid disease
    105090136 (IL4)
   05321 Inflammatory bowel disease
    105090136 (IL4)
   05330 Allograft rejection
    105090136 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    105090136 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cdk04052]
    105090136 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:cdk00536]
    105090136 (IL4)
Cytokines and growth factors [BR:cdk04052]
 Cytokines
  Interleukins
   105090136 (IL4)
Glycosaminoglycan binding proteins [BR:cdk00536]
 Heparan sulfate / Haparin
  Cytokines
   105090136 (IL4)
SSDB
Motif
Pfam: IL4 AAR2 DUF4942 DUF1732 SecIII_SopE_N
Other DBs
NCBI-GeneID: 105090136
NCBI-ProteinID: NP_001290483
UniProt: D7REK7
LinkDB
AA seq 133 aa
MGLTYQLISTLVCLLVCTSNFAHGHKCDITLQEIIKTLNTLTARKNSCMELTVADVFAAP
KNTTEKETFCKAATALRHIYRHHNCLSKHLSGLDRNLSGLANTTCSVNDSKKSTLRDFLE
RLKKIMKEKYSKC
NT seq 402 nt   +upstreamnt  +downstreamnt
atgggtctcacctaccaactgatctcaaccctggtctgcttactggtttgtaccagcaac
tttgcccacggacacaagtgtgatatcaccttgcaagagatcatcaaaacgctgaacacc
ctcactgcgagaaagaattcgtgcatggagctgactgtagcagacgtctttgctgcccca
aagaacacgactgagaaggaaaccttctgcaaggcggcaactgctcttcggcacatctac
agacaccacaactgcttgagcaaacacctgagcggacttgacaggaacctcagcggcctg
gcaaacacgacctgttctgtgaatgactccaagaagagcacattgagagacttcttggaa
aggctaaagaagattatgaaggagaaatactccaagtgttga

DBGET integrated database retrieval system