KEGG   Camelus dromedarius (Arabian camel): 105090194Help
Entry
105090194         CDS       T04642                                 

Gene name
APOA1
Definition
(RefSeq) apolipoprotein A-I
  KO
K08757  apolipoprotein A-I
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04975  Fat digestion and absorption
cdk04977  Vitamin digestion and absorption
cdk04979  Cholesterol metabolism
cdk05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105090194 (APOA1)
  09154 Digestive system
   04975 Fat digestion and absorption
    105090194 (APOA1)
   04979 Cholesterol metabolism
    105090194 (APOA1)
   04977 Vitamin digestion and absorption
    105090194 (APOA1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    105090194 (APOA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105090194 (APOA1)
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   105090194 (APOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein YtxH ApoLp-III DUF883 DUF4455 ApoC-I Exonuc_VII_L DUF948 DUF1640 DHC_N1 KMP11 TipAS DUF445 Atg14 OmpH Bacillus_HBL Cor1 Vac_Fusion RGS-like SF-assemblin BAR BshC DUF4015 Sec5 PIN_8 Prominin Phasin DUF2884 DUF1664 LMP FAM184 MRP-S27 DNA_primase_lrg KxDL Muted
Motif
Other DBs
NCBI-GeneID: 105090194
NCBI-ProteinID: XP_010979716
LinkDB All DBs
Position
33
AA seq 266 aa AA seqDB search
MKAVVLTLAVLFLTGSQARYFWQHDDPQSSWDRVKDFVTVYLDAVKDSGRDYVAQFEASA
LGKQLNLKLLDNWDSLSSTFSKLQEQLGPVTQEFWDRVEKETETLRQEMNKDLEEVKQKV
QPYLEDFQKKWQEEMEIYRQKVAPLGAELREDARQKMQELQEKLSPLAEEVRDRARAHVE
ALRLQLAPYSDDLRQRLAARFEALKEGGGASLADYHAKAAEQLKELGEKARPALEDLRQG
LLPVLESLKTSILAAIEEASKKLNPQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtggtgttgaccttggctgtgctcttcctcaccgggagccaggctcggtat
ttctggcagcatgatgacccccagtcatcctgggatcgggtgaaggattttgtcaccgtg
tacctggatgcagtcaaagacagcggcagggactatgtggcccagtttgaagcctctgct
ttgggaaaacaactcaacctgaaactcctggacaactgggacagcctgagcagcaccttc
agcaagctgcaggagcagctgggcccggtgacccaggagttctgggacagggtggaaaag
gagacggagacgctgaggcaggagatgaacaaggatctggaggaggtgaagcagaaggtg
cagccctacctggaagacttccagaagaagtggcaggaggagatggagatctatcgccag
aaggtggcgccgctgggcgcggagctgcgcgaggacgcgcgccagaagatgcaggagctg
caggagaagctgagcccgctggccgaggaggtccgcgaccgcgcgcgcgcccacgtggag
gcgctgcgcctgcagctggcgccctacagcgacgatctgcgccagcgcttggccgcccgc
ttcgaggcgctcaaggagggcggcggcgccagcctggccgactaccacgccaaggccgcc
gagcagctgaaagagctgggcgagaaggccaggcccgcgctggaggacctccgccagggc
ctgctgcccgtgctggagagcctcaagaccagcatcctggccgccatcgaagaggcctcc
aagaagctgaacccccagtga

DBGET integrated database retrieval system