KEGG   Camelus dromedarius (Arabian camel): 105090196Help
Entry
105090196         CDS       T04642                                 

Gene name
APOC3
Definition
(RefSeq) LOW QUALITY PROTEIN: apolipoprotein C-III
  KO
K08759  apolipoprotein C-III
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk03320  PPAR signaling pathway
cdk04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105090196 (APOC3)
  09154 Digestive system
   04979 Cholesterol metabolism
    105090196 (APOC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apo-CIII DUF624 ApoO
Motif
Other DBs
NCBI-GeneID: 105090196
NCBI-ProteinID: XP_031299181
LinkDB All DBs
Position
33
AA seq 80 aa AA seqDB search
MQPRLLFVAVFLVLLASARVTEAEDPSFAETVQGYVKQARDWVNERISSLKDYWSTFKEK
FSXFWEPIPKATPPLASEVA
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgcagccccggctcctcttcgtggctgtcttcctggtgctcctggcctctgcccgagtt
acagaggccgaggatccctcctttgcggaaacagtgcagggctacgtgaagcaggctagg
gactgggtgaatgaacgcatcagctccctgaaagactactggagcacattcaaggaaaag
ttctcttaattctgggagcctatccccaaggccacaccacctctggcctctgaagtcgcc
tga

DBGET integrated database retrieval system