KEGG   Camelus dromedarius (Arabian camel): 105090321
Entry
105090321         CDS       T04642                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk04012  ErbB signaling pathway
cdk04062  Chemokine signaling pathway
cdk04110  Cell cycle
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04310  Wnt signaling pathway
cdk04340  Hedgehog signaling pathway
cdk04360  Axon guidance
cdk04390  Hippo signaling pathway
cdk04510  Focal adhesion
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04657  IL-17 signaling pathway
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04722  Neurotrophin signaling pathway
cdk04728  Dopaminergic synapse
cdk04910  Insulin signaling pathway
cdk04916  Melanogenesis
cdk04917  Prolactin signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk04931  Insulin resistance
cdk04932  Non-alcoholic fatty liver disease
cdk04934  Cushing syndrome
cdk04935  Growth hormone synthesis, secretion and action
cdk05010  Alzheimer disease
cdk05020  Prion disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05135  Yersinia infection
cdk05160  Hepatitis C
cdk05162  Measles
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05200  Pathways in cancer
cdk05210  Colorectal cancer
cdk05213  Endometrial cancer
cdk05215  Prostate cancer
cdk05217  Basal cell carcinoma
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    105090321 (GSK3B)
   04310 Wnt signaling pathway
    105090321 (GSK3B)
   04340 Hedgehog signaling pathway
    105090321 (GSK3B)
   04390 Hippo signaling pathway
    105090321 (GSK3B)
   04151 PI3K-Akt signaling pathway
    105090321 (GSK3B)
   04150 mTOR signaling pathway
    105090321 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105090321 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105090321 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    105090321 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    105090321 (GSK3B)
   04657 IL-17 signaling pathway
    105090321 (GSK3B)
   04662 B cell receptor signaling pathway
    105090321 (GSK3B)
   04062 Chemokine signaling pathway
    105090321 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105090321 (GSK3B)
   04917 Prolactin signaling pathway
    105090321 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    105090321 (GSK3B)
   04919 Thyroid hormone signaling pathway
    105090321 (GSK3B)
   04916 Melanogenesis
    105090321 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    105090321 (GSK3B)
   04722 Neurotrophin signaling pathway
    105090321 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    105090321 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105090321 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105090321 (GSK3B)
   05225 Hepatocellular carcinoma
    105090321 (GSK3B)
   05226 Gastric cancer
    105090321 (GSK3B)
   05217 Basal cell carcinoma
    105090321 (GSK3B)
   05215 Prostate cancer
    105090321 (GSK3B)
   05213 Endometrial cancer
    105090321 (GSK3B)
   05224 Breast cancer
    105090321 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105090321 (GSK3B)
   05020 Prion disease
    105090321 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    105090321 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    105090321 (GSK3B)
   04931 Insulin resistance
    105090321 (GSK3B)
   04934 Cushing syndrome
    105090321 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    105090321 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    105090321 (GSK3B)
   05162 Measles
    105090321 (GSK3B)
   05163 Human cytomegalovirus infection
    105090321 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105090321 (GSK3B)
   05165 Human papillomavirus infection
    105090321 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105090321 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105090321 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cdk03036]
    105090321 (GSK3B)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     105090321 (GSK3B)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   105090321 (GSK3B)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105090321 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 105090321
NCBI-ProteinID: XP_010979871
LinkDB
Position
1
AA seq 433 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPSNATAASDANAGDRGQ
TNNAASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagcaaggtgaccacagtg
gtggcaactcctgggcagggtccagataggccacaagaagtcagctatacagatactaaa
gtgattggaaatggatcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggtggccatcaaaaaggtattgcaggataagagatttaagaaccgagagctccaaatc
atgagaaagctagatcactgtaacatagtccggttgcgttatttcttctactcaagtggt
gaaaagaaagatgaagtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacattatagtcgagccaaacagacgctccctgtgatctatgtcaagttg
tatatgtatcaactgtttcgaagtttagcctatatccattcctttggaatctgccatcgg
gatattaaaccacagaacctcttgttggatcctgatacagctgtcttaaaactttgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgcaggctgcgtgttagctgagctgttgctaggacaaccgatatttccaggggac
agtggtgtggatcaattggtggaaataatcaaggtcctggggacaccaacaagggagcaa
attagagaaatgaacccaaactacacagaattcaaattccctcaaattaaggcacatcct
tggactaaggattcgtcaggaacaggacatttcacctcaggagtgcgggtcttccggccc
cgaactccaccggaggcaattgcactgtgtagccgtctgctggagtatacaccaactgcc
cgattgacaccactggaagcttgtgcacattcattttttgatgaattacgggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctagctaccatccttattcctcctcatgcacggattcaagcagct
gcttcaaccccttcaaatgccacagcagcctcagatgcaaatgctggagaccgtggacag
accaataatgccgcttccgcatcagcttccaactccacctga

DBGET integrated database retrieval system