KEGG   Camelus dromedarius (Arabian camel): 105090416Help
Entry
105090416         CDS       T04642                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04614  Renin-angiotensin system
cdk04924  Renin secretion
cdk05142  Chagas disease (American trypanosomiasis)
cdk05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    105090416
   04614 Renin-angiotensin system
    105090416
 09160 Human Diseases
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    105090416
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    105090416
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cdk01002]
    105090416
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdk04147]
    105090416
   04090 CD molecules [BR:cdk04090]
    105090416
Enzymes [BR:cdk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105090416
Peptidases [BR:cdk01002]
 Metallo Peptidases
  Family M2
   105090416
Exosome [BR:cdk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105090416
CD molecules [BR:cdk04090]
 Proteins
  105090416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 105090416
NCBI-ProteinID: XP_010980016
LinkDB All DBs
Position
Un
AA seq 1301 aa AA seqDB search
MAAPAPPPPPLPLPLPPPPVVLALDPALQPGNFTADEAGAQLFAQSFNSSAEQVLFQSTT
ASWAHDTNITQENAQRQEEAALLTQEFSEAWGQKAKALYDPIWQNFSDPTLRRIISVVRT
LGPANLPLAKRQQYNSLLSNMTRIYSTAKVCFPNKTATCWSLDPELTNILAASRSYTLLL
YAWEGWHNAAGIPLKPLYQDFTALSNEAYKQDGFSDTGAYWRSWYDSPTFTEDLEHLYHQ
LEPLYLNLHAYIRRALHRQYGDRYINLRGPIPAHLLGDMWAQSWDNIYDMVVPFPDKPNL
DVTSTMVQKGWNATHMFRVAEEFFTSLGLLPMPPEFWAESMLEKPSDGREVVCHASAWDF
YNRRDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKGQHVSLRQGANPGFHEAIGDVLAL
STSTPAHLYKIGLLDHVTNDTENDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGHTPPS
RYNYDWWYLRTKYQGICPPVVRNETHFDAGAKFHIPNVTPYIRYFVSFVLQFQFHQALCK
EAGHQGPLHQCDIYQSTQAGAKLRKVLQAGSSQPWQEVLKDMVGSGALDAQPLLDYFLQP
VTQWLEEQNQRNGEVLGWPEYQWHPPMPDNYPEGIDLVSDETEASKFVEEYDRISQVVLN
QYAEANWNYNTNITSEGSKMLLEMSTQMANHTVKYGTWARKFDVTNFQNATVKRMIKKIQ
DLERAALPVKELEEYNQILLDLETKYSVASVCHANGTCLQLEPDLSNLMATSRNYEELLW
AWKGWRDKVGRAILPHFPRYVELTNKAARLNGYVDGGDSWRSMYEMPFLEHDLEQLFQQL
QPLYLHLHAYVRRALHRHYGPEHINLEGPIPAHLLGNMWAQSWSNIYDLVVPFPSAPRMD
VTEAMIKQGWTPQRIFKEADNFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFF
NGKDFRIKQCTSVNMEDLVVAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGDVLALS
VTTPKHLYNINLLSSEDGGYEEDINFLMKMALDKIAFVPFSYLVDQWRWRVFDRSITKEN
YNQEWWSLRLKYQGLCPPVARSQGDFDPGAKFHIPSSVPYIRYFISFIIQFQFHEALCQA
AGHQGPLHKCDIYQSKEAGKRLADAMKLGFSQPWPEAMKLITGQPNMSASAIMTYFKPLL
DWLQTENGRHGETLGWPQYNWTPNSARLEGSLLGTGRVNFLGLNLEEQQARVGQWVLLFL
GVTLLVATLGLTQRLFSVRHHSLHQPHRGPQFGSEVELRHS
NT seq 3906 nt NT seq  +upstreamnt  +downstreamnt
atggcggccccggccccccccccccccccgctccccctgccgctgccgccaccaccggta
gtcctggcgctggaccccgcgctacagcccgggaactttaccgccgacgaggccggggca
cagctcttcgctcagagcttcaattcgagcgccgagcaggtgctgttccagagcacgacc
gccagctgggcgcacgacaccaacatcacccaggagaacgcgcagcgccaggaggaggca
gccctgctcactcaggagttttcagaggcctggggccagaaggccaaagctctgtacgac
ccaatctggcagaacttcagtgaccccacgctgagacgcatcataagtgtcgtgcgcacc
ctgggccctgccaacctgcccctggcaaagcggcagcagtacaactctctgctaagcaac
atgaccaggatttactccacagccaaggtctgcttccccaacaagactgccacctgctgg
tccctggacccagagctcaccaacattctggctgcctcgcgaagctacactctgctgcta
tatgcctgggagggctggcacaacgccgcaggcatcccactgaaacccctgtaccaggac
ttcactgccctcagcaatgaggcctacaagcaggatggcttctcagacacgggggcctac
tggcgctcctggtacgactctcctaccttcacggaggatctggagcatctctaccatcag
ctagagcccctctacctgaatctccatgcctacatccgccgcgcgctgcaccgccagtat
ggggacagatacatcaacctcaggggacccatccctgctcacctgctgggggacatgtgg
gcccagagctgggacaacatctacgacatggtggtgcctttccctgacaagcccaatctt
gatgttaccagtactatggtacagaagggctggaatgctacgcacatgttccgggtggca
gaggaattcttcacctccctggggctcttgcccatgcctcctgagttttgggcagagtcc
atgctggagaaaccaagtgatgggcgcgaggtggtgtgccatgcctctgcctgggacttc
tacaacaggagagacttcaggatcaagcagtgcacacgggtcaccatggaccagctgtcc
acggtgcaccacgagatgggccacgtgcaatactatctgcagtacaagggccagcacgtc
tccctgcgccaaggcgccaacccaggcttccacgaagccattggggatgtgctggcactc
tccacttccactcctgcacatctgtacaaaattggcctgctggaccatgtcaccaatgac
acggaaaatgacatcaattacttgttaaagatggcactggaaaaaattgctttcctgcct
tttggctacttggtggaccagtggcgttggggggtctttagtgggcataccccaccttca
cgatacaactatgactggtggtatcttcgaaccaagtatcaggggatctgtcctccagtt
gtccgaaacgaaacccattttgatgctggggccaagtttcacatcccaaatgtgacaccg
tacatcaggtactttgtgagttttgtcctgcagttccagttccatcaagccctgtgcaag
gaggcaggccaccagggcccactgcaccagtgtgacatctaccagtccacccaggcgggg
gccaagctccggaaggtgctgcaggcaggctcctcacagccctggcaggaggtgctgaag
gacatggtcggctcaggtgccctggatgctcagccgctgcttgactacttcctccagcca
gtcacacagtggctggaggagcagaaccagcggaacggcgaggtcctgggctggccagaa
tatcagtggcacccaccgatgcctgacaattacccagagggcattgacctagtgtccgat
gagactgaggccagcaagtttgtagaggaatatgaccggatatcccaggtggtattgaac
cagtacgcagaggccaactggaactacaacaccaatatcacatcggagggcagcaagatg
ttgctggagatgagcacacagatggcaaaccacaccgtcaagtacggcacctgggctagg
aagttcgatgtcaccaacttccagaatgccaccgtgaagcggatgataaagaagattcag
gatctagagcgggcagcgctgcctgtcaaggagctggaggagtacaaccagatcctgctg
gacttggaaaccaagtacagcgtggcctctgtgtgccacgccaatggcacttgtctacag
ctggagcctgatctgtcgaatctgatggccacatcccggaactatgaagaactgctgtgg
gcatggaagggctggcgagacaaggtggggagggccattcttcctcatttccccagatat
gtcgagctcaccaacaaggctgccaggctcaatggctatgtagatggaggggactcctgg
agatctatgtacgagatgccattcctggagcatgacctggagcagcttttccagcagctg
cagccactctacctgcacctacatgcctacgtgcgccgggccctgcaccgccactacggg
cctgagcacatcaacctggagggccccatcccagctcatctgctggggaacatgtgggca
cagagctggtccaacatctatgacttggtggtacccttcccctcagcccccaggatggat
gtcacagaggccatgataaagcagggctggacaccccaaaggatatttaaagaagcagac
aatttcttcacctccctggggctgctgcctgtgccccccgagttctggaacaagtcgatg
ctggagaagccaactgatgggcgggaggtggtgtgccacgcctctgcctgggacttcttc
aatggcaaggacttcaggatcaagcagtgcacttctgtcaacatggaggacctggtggtg
gcccaccacgaaatgggccacatacagtacttcatgcagtacaaggacctgcctgtgacc
ttccgggagggggccaacccaggctttcatgaggccattggggacgtgctggccctctca
gtgactacccccaaacacctgtacaacatcaacctgctgagtagtgaggatggcggctat
gaggaggacatcaactttctgatgaagatggcgctcgacaagatcgcctttgtccccttc
agctacctcgttgaccagtggcgctggagggtgtttgacagaagcatcaccaaggagaac
tacaaccaggagtggtggagcctcaggctgaaataccagggcctctgtccaccagtggcc
aggtctcaaggcgactttgacccaggggccaagttccacattccttcaagtgtgccttac
atcagatacttcatcagcttcatcatccagttccagttccacgaggcactgtgccaggcg
gcgggccaccagggtcccctgcacaagtgtgacatctaccagtccaaggaggccgggaag
cgcctggcggatgccatgaagctgggcttcagtcagccatggccggaagccatgaagctg
atcacaggccagcccaacatgtccgcctctgccataatgacctacttcaagccactgctg
gactggctccagactgagaacgggcggcacggggagacgctgggctggcctcagtacaac
tggacgccaaactctgctcgcttggaaggctccctcctgggcactggccgcgtcaacttc
ctgggcctgaacctggaggagcagcaggcccgcgtgggccagtgggtgctgcttttcctg
ggtgtcaccctgttggtggccaccttgggcctcacccagcggctcttcagcgtccgccac
cacagcctgcaccagccccaccgtgggccccagtttggctctgaggtggagctgagacac
tcctga

DBGET integrated database retrieval system