KEGG   Camelus dromedarius (Arabian camel): 105090427Help
Entry
105090427         CDS       T04642                                 

Gene name
IL9
Definition
(RefSeq) interleukin-9
  KO
K05432  interleukin 9
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04060  Cytokine-cytokine receptor interaction
cdk04630  Jak-STAT signaling pathway
cdk05310  Asthma
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    105090427 (IL9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105090427 (IL9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    105090427 (IL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cdk04052]
    105090427 (IL9)
Cytokines and growth factors [BR:cdk04052]
 Cytokines
  Interleukins
   105090427 (IL9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL7 Dynamin_M
Motif
Other DBs
NCBI-GeneID: 105090427
NCBI-ProteinID: XP_010980033
LinkDB All DBs
Position
3
AA seq 141 aa AA seqDB search
MLLSVVLASALLLCSVASQGCLTLTGIKDAEYLINNLQKHPPSKCSCSSNVTDCLCLPIP
SDNCTTACFQEGLTQMANTTLKTRFPLIFNRVKKTVEALKNNKCGSFSCEQPCNQTIAGN
TLTFLRSLLESFQKERMRGRV
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgtccgtggtccttgcctcggccctgctcctctgctctgtggccagccagggg
tgtttgaccttgactgggatcaaggatgctgagtacctcatcaacaacctgcagaaacat
ccaccttcaaaatgcagctgcagcagcaacgtgactgactgtttgtgtctgcccattcct
tctgacaactgcaccacggcatgcttccaggagggtctgacacagatggccaacacaaca
ctgaaaacaagattccccctgattttcaatagggtgaagaaaacggttgaagccctcaag
aacaacaagtgtggctctttttcctgtgaacagccatgcaaccaaaccatagcaggcaat
acactgacattcctgaggagtctcctggaaagtttccagaaagaaaggatgagaggcaga
gtgtga

DBGET integrated database retrieval system