KEGG   Camelus dromedarius (Arabian camel): 105090638Help
Entry
105090638         CDS       T04642                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  anaphase-promoting complex subunit 8
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04110  Cell cycle
cdk04114  Oocyte meiosis
cdk04120  Ubiquitin mediated proteolysis
cdk04914  Progesterone-mediated oocyte maturation
cdk05166  Human T-cell leukemia virus 1 infection
Module
cdk_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    105090638 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105090638 (CDC23)
   04114 Oocyte meiosis
    105090638 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    105090638 (CDC23)
 09160 Human Diseases
  09167 Infectious diseases
   05166 HTLV-I infection
    105090638 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cdk04121]
    105090638 (CDC23)
   03036 Chromosome and associated proteins [BR:cdk03036]
    105090638 (CDC23)
Ubiquitin system [BR:cdk04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     105090638 (CDC23)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    105090638 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 TPR_16 ANAPC3 TPR_17 TPR_12 TPR_9 DUF772 TPR_15
Motif
Other DBs
NCBI-GeneID: 105090638
NCBI-ProteinID: XP_010980288
LinkDB All DBs
Position
Un
AA seq 597 aa AA seqDB search
MAASSSVVPVVATAAVVPVLSSSADFSNLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLSELQPPPPVTEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPSTEMPAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggctgccagctcctctgtagtcccggtggtcgcgaccgctgctgtggtgccggtcctg
tcatccagcgctgatttctcaaatttgcgggaaattaaaaagcagctgctactcatcgca
ggccttacccgggagcggggcctactgcacagtagcaaatggtctgccgagttggccttc
tccctcccggcgttgcctctgtccgagctgcagcctccaccgcctgttacagaggaggat
gcccaggatatggatgcttacacactggccaaggcctactttgacgttaaagaatatgat
cgggcagcacatttcctgcatggctgcaatagcaagaaagcctatttcctgtacatgtat
tctagatacctgtctggagaaaagaagaaggatgatgaaacagttgatagtctaggcccc
ctggagaaaggacaagtgaaaaatgaggctcttagagaattgagagtggagctcagcaaa
aaacaccaggctcgggaacttgatggatttggcctttatctgtatggtgtggtgcttcga
aagctggacttggtgaaagaggccattgatgtatttgtggaggctactcatgttttgcct
ttgcactggggagcctggctagaactctgtaacttgattacagacaaggagatgctgaag
ttcctgtctttgccagacacctggatgaaagagttttttctcgctcatatatacacagag
ttgcagttgatagaggaggccctgcaaaagtatcagaatctcattgatgtgggcttctct
aagagctcatatattgtttcccaaattgcagttgcctatcacaatatcagagatatcgac
aaagccctctctatttttaatgagctaaggaaacaagacccttacaggattgaaaatatg
gacaccttctccaaccttctttatgtcaggagcatgaagtctgagttgagttacctggct
cacaacctctgtgagattgataaatatcgtgtagaaacatgctgtgtaattggcaattat
tatagtttgcgttctcagcacgagaaggcagccctgtatttccagagagccctgaaatta
aatcctcggtatcttggggcctggacactgatgggacatgagtacatggaaatgaagaac
acatctgctgctattcaggcttataggcatgccattgaggtcaataagcgggactacaga
gcctggtatggccttgggcagacctatgaaatccttaagatgccattttattgtctttat
tattacagacgggcccaccagcttcggcccaatgattcccgtatgctagtcgctttagga
gaatgttatgagaaactcaatcaactagtggaagccaaaaagtgttattggagagcttac
gcagtgggagatgtggagaaaatggctctggtgaaactggcaaagcttcatgaacagttg
actgagtcagaacaggcagcccagtgttacatcaaatacatccaagatatctattcgtgt
ggggaaatagtggaacacttagaggagagcactgctttccgctatctggcccagtactat
tttaagtgcaagctgtgggatgaagcttcaacttgtgcccaaaagtgttgtgcattcaat
gatacccgagaagaaggtaaggccttgcttcggcaaatcctacagcttcggaaccaaggc
gagactccctccacagagatgcctgctccctttttcctccctgcttcactgtctgctaac
aacactcccacacgcagagtttctccactcaacctgtcttcagtcacaccatag

DBGET integrated database retrieval system