KEGG   Camelus dromedarius (Arabian camel): 105090693
Entry
105090693         CDS       T04642                                 

Gene name
ACAA1
Definition
(RefSeq) 3-ketoacyl-CoA thiolase, peroxisomal
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00071  Fatty acid degradation
cdk00280  Valine, leucine and isoleucine degradation
cdk00592  alpha-Linolenic acid metabolism
cdk01040  Biosynthesis of unsaturated fatty acids
cdk01100  Metabolic pathways
cdk01212  Fatty acid metabolism
cdk03320  PPAR signaling pathway
cdk04146  Peroxisome
Module
cdk_M00087  beta-Oxidation
cdk_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105090693 (ACAA1)
   00592 alpha-Linolenic acid metabolism
    105090693 (ACAA1)
   01040 Biosynthesis of unsaturated fatty acids
    105090693 (ACAA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    105090693 (ACAA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105090693 (ACAA1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105090693 (ACAA1)
Enzymes [BR:cdk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     105090693 (ACAA1)
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Other DBs
NCBI-GeneID: 105090693
NCBI-ProteinID: XP_031325824
LinkDB
Position
17
AA seq 426 aa
MLRLQVVLGHLKGQPASASEPAPQAAPCWSGAPRAPAEDVVVVHGRRTAIGRSGRGGFKD
TTPDELLSAVMTAVLRDVKLSPDQLGDICVGNVLQPGAGAVMARIAQFLSDIPETVPLSS
VNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLVEKEKARDCL
IPMGITSENVAEQFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDTGTER
TITVAQDEGIRPSTTLEGLAKLKPAFKKGGSTTAGNSSQVSDGAAAILLARRSKAEELGL
PILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLMVDDVDIFEINEAFASQAVYCVEK
LKLPLEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAV
FEYPGN
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgctgaggctccaggtggtgctcggccacctgaaaggccagcccgcttcggcctcggag
ccggcgccgcaggccgcgccgtgttggagcggcgctccgcgggcgccggccgaggacgta
gtggtggtgcacgggcgccgcacggccattggccgatcgggccgcggcggcttcaaggac
accacccccgacgagcttctctcggccgtcatgaccgcggttctccgggacgtcaagctg
agcccggaccagctgggggatatctgcgtgggaaacgtgcttcagcctggggccggagca
gttatggcccgaatcgcccagtttctgagtgacatcccagagactgtgcctttgtccagt
gtcaatagacagtgttcatcgggactccaggcggtggccagcatagctggtggcatcaga
aatgggtcttatgacattggcatggcttgtggggtggagtccatgtcgctggctgacaga
gggaaccctggcaatattacttcacgcttggtggagaaagagaaggccagagactgcctg
attcctatggggataacctcagagaatgtagctgagcagtttggcatttcaagggagaag
caggacacctttgcactggcttcccagcaaaaggcagccagagcccagagcaagggctgt
ttccaagccgagatcgtgcctgtgaccaccacagtccatgacgacacgggcactgagagg
accatcactgtggcccaggatgagggcatccgccccagcaccaccttggagggcctggcc
aaactaaagcccgccttcaagaaggggggctcgactacggctgggaactccagccaggtg
agtgacggggcagctgctatcctgttggcccggaggtccaaggcagaagagttgggcctt
cccatcctgggtgtcctgaggtcctatgcagtggttggggtcccgcctgacatcatgggc
attggacctgcctatgccatccctgtagctttgcaaaaagcagggctgatggtggatgac
gtggacatcttcgagatcaatgaggcctttgccagtcaggccgtctactgtgtggagaag
ctgaaactaccccttgagaaggtgaaccctctgggaggggccgtggccttgggccacccg
ctgggctgcactggggcgcgacaggtcatcacgctgctcaacgagctgaagcgccgcggg
aagagggcatacggggtggtgtccatgtgcatcgggaccggcatgggagccgccgctgtc
ttcgagtaccctgggaactga

DBGET integrated database retrieval system