KEGG   Camelus dromedarius (Arabian camel): 105090773
Entry
105090773         CDS       T04642                                 

Gene name
SCP2
Definition
(RefSeq) non-specific lipid-transfer protein
  KO
K08764  sterol carrier protein 2 [EC:2.3.1.176]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00120  Primary bile acid biosynthesis
cdk01040  Biosynthesis of unsaturated fatty acids
cdk01100  Metabolic pathways
cdk01212  Fatty acid metabolism
cdk03320  PPAR signaling pathway
cdk04146  Peroxisome
Module
cdk_M00861  beta-Oxidation, peroxisome, VLCFA
cdk_M00862  beta-Oxidation, peroxisome, tri/dihydroxycholestanoyl-CoA => choloyl/chenodeoxycholoyl-CoA
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    105090773 (SCP2)
   01040 Biosynthesis of unsaturated fatty acids
    105090773 (SCP2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105090773 (SCP2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105090773 (SCP2)
Enzymes [BR:cdk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.176  propanoyl-CoA C-acyltransferase
     105090773 (SCP2)
SSDB
Motif
Pfam: SCP2 Thiolase_N Thiolase_C Alkyl_sulf_C ACP_syn_III ketoacyl-synt SCP2_2 Ketoacyl-synt_C SpoVAD
Other DBs
NCBI-GeneID: 105090773
NCBI-ProteinID: XP_010980422
LinkDB
Position
13
AA seq 544 aa
MPVATARSQPRNRVFVVGVGMTKFTKPGLEDSRDYPNLAKEAGQKALTDAQIPYSAVEQA
CVGYIYGDSTCGQRAIYHSLGLTGIPIINVNNNCSTGSTALFMARQLIQGGLADCVLALG
FEKMEKGPIVNSFSSRTNPLDKHIEVLINKYGLSAQPVTSQMFGCAGKEHMEKYGTKIEH
FAKIGWKNHKHSVNNPYSQFQKEYSLEEVMTSRNIFDFLTVLQCCPTSDGAAAAVLASEA
FVQKHGLKSKAVEILAQEMVTDKPSSFEENSVIKMVGFDMSKEAARKCYEKSGLKPSDID
VIELHDCFSTNELLTYEALGLCPEGQGGKLVDRGDNTYGGKWVINPSGGLISKGHPIGAT
GLAQCAELCWQLRGEAGKRQVPGAKVALQHNIGLGGAVVVTLYKMGFPEAARTHQIEAAP
TSSAVDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPEGKEATWVVDVKNGKG
SVLPNSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPG
KAKL
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgcctgtcgccacagcacggtctcagccccggaaccgggtgtttgtggtgggggttggg
atgaccaagttcacaaagcctggacttgaggattcaagagactaccctaatttggcaaag
gaagcaggccagaaggctttaacagatgctcagatcccatattcagcagtggaacaggca
tgtgttggctacatttatggtgactctacctgtgggcagagggctatctatcacagtttg
ggactgactggaattcctataatcaacgtcaataacaactgttctactggttcgactgca
ttgtttatggcccggcagttgattcagggtggtctggcagattgtgtcttggctcttggc
tttgagaagatggagaagggacccattgtaaattcattttcatctaggaccaatccactt
gataaacatattgaggtcctgatcaataagtacggattgtctgcccaaccagttacttct
cagatgtttgggtgtgctggaaaagagcacatggaaaaatacggaacaaaaattgaacac
tttgcaaaaattggatggaaaaatcacaaacattcagttaataacccgtattcccagttc
caaaaggagtacagtttagaagaagtgatgacctctcgaaacatttttgattttttgact
gtcttacagtgttgtcccacttcagatggtgctgcggcggcagttttggcgagtgaagca
tttgtacagaagcatggcctgaaatccaaagctgtggaaattctggcacaagagatggtg
actgataagccaagctcatttgaagaaaacagtgttattaaaatggttggctttgatatg
agtaaagaagctgccagaaagtgctatgagaaatctggtctgaaaccaagtgatattgat
gtaatagaacttcatgattgcttttctactaatgaactccttacttatgaagcactggga
ctctgtccagaaggtcaaggtggaaaactggttgatagaggagataatacttatggagga
aagtgggtcataaatcctagtggtggattgatttcaaagggacacccaattggagctaca
ggtctggctcagtgcgcagaactctgctggcagctgagaggggaagccggaaagaggcaa
gttcctggtgcgaaggttgctctgcagcataatataggccttggaggagctgtagttgtc
acgctgtacaagatgggttttcctgaagctgccagaactcatcaaattgaggctgctcca
accagctctgcagttgatggatttaaggcaaatcttgtgtttaaggagattgagaagaag
cttgaagaggaaggggagcagtttgtgaagaaaattggtggtatttttgccttcaaggtg
aaagatggccctgagggtaaagaagccacctgggtggtggatgtgaagaacggcaaagga
tcagtgctccctaactcagataagaaggccgactgcacaatcacaatggctgactcggac
ttactggctttgatgactggtaaaatgaatcctcagtcggccttctttcaaggcaaattg
aaaatcactggcaacatgggtctggctatgaagttacaaaatcttcagcttcaaccaggc
aaagctaagctgtga

DBGET integrated database retrieval system