KEGG   Camelus dromedarius (Arabian camel): 105090816
Entry
105090816         CDS       T04642                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    105090816 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105090816 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cdk03310]
    105090816 (NR3C1)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    105090816 (NR3C1)
Nuclear receptors [BR:cdk03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   105090816 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 SCA7
Other DBs
NCBI-GeneID: 105090816
NCBI-ProteinID: XP_010980471
LinkDB
Position
3
AA seq 783 aa
MDPKESLSTPSREEIPSSVLVRERGNVVDFYKTLRGGATAKASASSPSLAAASQSDSKQQ
RLLVDFPKGSGSNNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPPQGQTSLSSGETD
FRLLEESIANLNKSTSVPENPKNSAPAAVSAAPTEREFQKTHSDVSSEQHHLKGQTGTNG
GNVKLYATDQSTFDVWRKKLQDLEFPSGSPGKETSESPWSSDLLIDDNCLLSPLAGEGDP
FLLEGSSNEDYKPLVLPDTKPKVKDNGDLILPSPTSVPVPQVKTEKEDFIELCTPGVIKQ
EKLGPVYCQASFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVI
PPLPVGSENWNRCQGSGDDNLTSLGTLNFPGRSVFSNGYSSPGMRPDVNSPPSSSSAATG
PPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCP
ACRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSPDTSENPANKTIVPTTLPQLTPTLVS
LLEVIEPEVLYAGYDSSVPDTTWRLMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMT
LLQYSWMFLMAFALGWRSYRQSNANLLCFAPDLVINEQRMALPCMYDQCKHMLYVSSELH
RLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQR
FYQLTKLLDSMHDVVENLLKYCFQTFLDKSLSVEFPEMLAEIITNQIPKYSSGNIKKLLF
HQK
NT seq 2352 nt   +upstreamnt  +downstreamnt
atggaccccaaggaatctttaagcacccccagtagagaagagatccccagcagtgtgctt
gttcgggagaggggaaatgtggtggacttctataaaaccctaaggggaggagctactgcg
aaggcttctgcatcttcaccctcactggctgccgcttcacagtcagactccaagcagcag
agacttttggttgattttccaaaaggctcaggaagcaacaacgcgcagcagccagatctg
tccaaggcagtttcactctcaatgggactgtatatgggagagacagaaacaaaagtgatg
ggaaatgacctgggattcccaccgcagggccaaaccagcctttcctctggggagacagac
tttcggcttctggaagaaagcatcgcgaacctcaataagtcgaccagtgttccagagaac
cccaagaactcggcacctgctgccgtgtctgctgcccccacagagagggaatttcaaaag
actcactctgacgtgtcttcagaacagcatcatttgaagggccagactggcaccaacggg
ggtaatgtgaagttgtatgccacagaccaaagcacctttgatgtttggaggaaaaaactc
caggacttggagtttccttctgggtccccaggtaaagaaacgagtgagagtccttggagc
tcagacctcttgatagatgacaactgtttgctttctcctttggcaggagagggtgacccg
ttccttttggaaggaagctcaaatgaggactataagcctcttgttttaccggacactaaa
cctaaagttaaggataatggagacctgatcttaccaagccccaccagtgtgccagtgccc
caggtgaaaacagaaaaagaagattttattgaactctgcacccctggggtaattaagcag
gagaaactgggcccagtttactgtcaggcaagcttttctggggcaaatataattggtaat
aaaatgtctgccatttctgttcatggtgtgagtacctctgggggacagatgtaccactat
gacatgaatacagcatccctttctcaacagcaggatcagaaacctatttttaatgtcatt
ccaccacttcctgttggttcagaaaattggaatagatgccaaggatctggagatgataac
ttgacttccttggggactttgaacttcccaggtcgatcggttttttctaatggctactca
agccctggaatgagaccagacgtcaactctcctccatccagctcttcagcggccacggga
ccacctcccaaactctgcctggtgtgctcggatgaagcttcgggatgtcactatggggtc
ctgacttgtggaagctgtaaagtattcttcaaaagagcagtggaaggtagacagcacaat
tacctttgtgctggaagaaatgattgtatcatcgataaaattcgaaggaaaaactgcccc
gcctgccgctatagaaaatgtcttcaagctggaatgaacctggaagctcgaaaaacaaag
aagaagataaaaggaattcagcaggccactacaggagtctcaccagacacttctgaaaac
cctgctaacaaaacaatagttcctacaacattaccacaactcacgcctaccctggtgtca
ctgctggaggtcatcgaacccgaggtgttatacgcagggtacgacagttctgttccggat
acgacgtggcggctcatgaccacactcaatatgctaggggggaggcaggtgattgcggca
gtcaagtgggcaaaggccataccaggattcaggaacttacacctggatgaccaaatgacc
ctacttcagtattcgtggatgttcctcatggcattcgccctgggatggagatcctacaga
caatcgaacgcaaacctgctctgttttgctcctgatctggttattaatgagcagagaatg
gctttaccctgcatgtatgaccaatgtaaacatatgctgtatgtttcctctgagttacac
aggcttcaggtatcttacgaagagtacctctgtatgaaaaccttactgctcctctcttca
gttcctaaggaaggtttgaagagccaagagctatttgatgagattagaatgacctacatc
aaagagctaggaaaagccattgtcaagagggaagggaactccagtcagaactggcagcgg
ttttatcaactgacaaaactcttggactccatgcatgatgtggttgaaaatctccttaag
tattgcttccagacatttttggataagtccttgagcgttgaattcccagagatgttagct
gaaatcatcaccaatcaaataccaaaatattcaagtggaaatatcaaaaaacttctgttt
catcaaaagtga

DBGET integrated database retrieval system