KEGG   Camelus dromedarius (Arabian camel): 105090854
Entry
105090854         CDS       T04642                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04022  cGMP-PKG signaling pathway
cdk04141  Protein processing in endoplasmic reticulum
cdk04151  PI3K-Akt signaling pathway
cdk04211  Longevity regulating pathway
cdk04261  Adrenergic signaling in cardiomyocytes
cdk04668  TNF signaling pathway
cdk04728  Dopaminergic synapse
cdk04911  Insulin secretion
cdk04915  Estrogen signaling pathway
cdk04918  Thyroid hormone synthesis
cdk04925  Aldosterone synthesis and secretion
cdk04926  Relaxin signaling pathway
cdk04927  Cortisol synthesis and secretion
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04934  Cushing syndrome
cdk04935  Growth hormone synthesis, secretion and action
cdk05020  Prion disease
cdk05030  Cocaine addiction
cdk05031  Amphetamine addiction
cdk05034  Alcoholism
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105090854 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    105090854 (ATF6B)
   04022 cGMP-PKG signaling pathway
    105090854 (ATF6B)
   04151 PI3K-Akt signaling pathway
    105090854 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    105090854 (ATF6B)
   04915 Estrogen signaling pathway
    105090854 (ATF6B)
   04926 Relaxin signaling pathway
    105090854 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    105090854 (ATF6B)
   04918 Thyroid hormone synthesis
    105090854 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    105090854 (ATF6B)
   04925 Aldosterone synthesis and secretion
    105090854 (ATF6B)
   04927 Cortisol synthesis and secretion
    105090854 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105090854 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    105090854 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    105090854 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    105090854 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    105090854 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    105090854 (ATF6B)
   05031 Amphetamine addiction
    105090854 (ATF6B)
   05034 Alcoholism
    105090854 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105090854 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105090854 (ATF6B)
   05161 Hepatitis B
    105090854 (ATF6B)
   05163 Human cytomegalovirus infection
    105090854 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105090854 (ATF6B)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    105090854 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 105090854
NCBI-ProteinID: XP_010980532
LinkDB
Position
20
AA seq 708 aa
MVGGRGGKMAELMLLSEIADPTRFFTDNLLSPEDWDSTLYAGLDEVAEEQTQLFRCLEQD
VPFGSSPLDLGMDISPPEPPWDPLPISPDLQVKSEPSSPCSSSSLSSESSHLSTEPSTQA
SGVGEVLVVKTESLAPPLCLLGDDPTSPFETVQINVGPTADDPSDVQIKIEPVSPSSSIN
SEASLLSAESSSQAFIGEEVLEVKTESPSPQGCLLRDVAGAPLGAVQISVGPSSDGSSGK
ALPARKPPLQPKPVVITAVPMPPRAVPPSTAVLLQPLVQPPPVSPVLLIQGAIRVQPEGP
NPPAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEA
RLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFVAFNFGPVS
ISEPPPAPISPRMSREEPRPRRHLLGFSAQEPVHGAEPPQRPSQGPEEPQPSPAGQPSFR
NLTAFPGGARELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKVPPRAQ
ERQKSQLWKKSPPFKAVPTQPLGPPERDSVGQLQLYRHPDRSQPEFLDAIDRREDTFYVV
SFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGPPGDYEEMMQIECEVMDTRVI
HIKTSTVPPSLRKQPSSTPGNATGGPLPASASSQAPPAAHQPLYLNHP
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggttggggggcgggggggaaagatggcggagctgatgcttctcagcgagattgcggat
ccgacgcgttttttcaccgataatttgctgagcccggaggactgggacagcaccttgtac
gccggcctggatgaagtggccgaggagcagacgcagctcttccgttgcctggagcaggat
gtcccgtttggcagcagccccctggacttggggatggatatcagccctcccgaacccccc
tgggaccctctgcctatctctccagatcttcaggtgaagtctgagccatcctctccctgc
tcttcctcctccctcagctctgaatcatcacatctttccacagagccctccacccaggcc
tctggtgtaggggaggtgctggttgtgaagacagagtccttggcacccccactctgcctc
ctgggagatgatccaacatccccatttgaaactgtccagatcaatgtgggccccaccgcc
gatgatccctcagatgtccagattaagatagaacctgtctctccatcttcctccatcaac
tctgaggcgtccctgctctctgcagagtcctccagccaggcttttataggagaggaggta
ctggaagtgaagacagagtccccatcccctcaaggctgtctcctgcgggatgtcgcaggc
gccccacttggtgccgttcagatcagcgtgggcccatcctccgatggctcctcaggcaaa
gccctgcccgcccggaagccaccgctgcagcccaaacctgtggtgataactgctgtcccg
atgccacccagagctgtgcctcccagcaccgctgtccttctgcagcccctcgtccagcca
cccccagtgtcgccagtcctcctcatccaaggtgctattcgagtccagcctgagggaccg
aacccccctgctccaagacctgagaggaagagcattgttccagctcctatgccagggaac
tcctgcccacctgaggtggatgcgaagctgctgaagcggcagcagcgaatgatcaagaac
cgggagtcagcctgccagtcccggaggaagaagaaagagtacctgcaggggctggaagcg
aggctgcaggccgtgctggccgacaaccagcagctccggcgggagaatgctgccctccgc
cggcggctggaggccctgctggctgagaacagcgagctcaagttagggtccggaaacagg
aaggtggtctgcatcatggtcttccttctcttcgttgccttcaactttgggcctgtcagc
atcagtgagcctcctccagctcccatctctcctcggatgagcagagaggagcctcgaccc
cggagacacttgctggggttctcggcccaagagcctgttcatggagctgagcccccgcag
cgtccttctcagggccccgaggagccccagcccagccctgcaggccagccaagcttcagg
aacctgacggccttccccgggggcgccagggagctgctgctgagagacctggaccagctc
ttcctctcctctgattgccggcacttcaaccgaactgagtccctgaggcttgctgatgag
ctcagtggctgggtccagcgccaccagagaggccggcggaaggtccctccgagggcccag
gagaggcagaagtctcagctatggaagaagtcacctccatttaaggcagtccccacccag
ccccttgggcccccagaaagggattctgtgggccagctacagctatatcgccacccagac
cgttcgcagccagagttcctggatgcaatcgaccgacgggaggacacattttatgttgtc
tccttccgaagggaccacctgctgctcccagccatcagccacaacaagacctctcggccc
aagatgtccctggtgatgcccgccatggcccccaatgagaccctgtcaggccgggggccc
ccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacacccgggtgatt
cacatcaagacctccacagtgcccccctcgctccgaaaacagccgtcctccaccccgggc
aatgccacaggcggccccttgccagcttctgcatccagccaggcccccccggctgcccat
cagcccctctacctcaatcatccctga

DBGET integrated database retrieval system