KEGG   Camelus dromedarius (Arabian camel): 105091004
Entry
105091004         CDS       T04642                                 

Gene name
FOXO1
Definition
(RefSeq) LOW QUALITY PROTEIN: forkhead box protein O1
  KO
K07201  forkhead box protein O1
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04068  FoxO signaling pathway
cdk04152  AMPK signaling pathway
cdk04211  Longevity regulating pathway
cdk04213  Longevity regulating pathway - multiple species
cdk04218  Cellular senescence
cdk04910  Insulin signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk04922  Glucagon signaling pathway
cdk04931  Insulin resistance
cdk04933  AGE-RAGE signaling pathway in diabetic complications
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05202  Transcriptional misregulation in cancer
cdk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105091004 (FOXO1)
   04152 AMPK signaling pathway
    105091004 (FOXO1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    105091004 (FOXO1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    105091004 (FOXO1)
   04922 Glucagon signaling pathway
    105091004 (FOXO1)
   04919 Thyroid hormone signaling pathway
    105091004 (FOXO1)
  09149 Aging
   04211 Longevity regulating pathway
    105091004 (FOXO1)
   04213 Longevity regulating pathway - multiple species
    105091004 (FOXO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105091004 (FOXO1)
   05202 Transcriptional misregulation in cancer
    105091004 (FOXO1)
  09162 Cancer: specific types
   05215 Prostate cancer
    105091004 (FOXO1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    105091004 (FOXO1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105091004 (FOXO1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105091004 (FOXO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105091004 (FOXO1)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    105091004 (FOXO1)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 105091004
NCBI-ProteinID: XP_031321792
LinkDB
Position
14
AA seq 651 aa
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGGAAANPDAAAGLPS
ASAAAVNADFMNNLSLLEESGDFQQAPGSVAAAAVVAGRQRRRCCHGGLGDLGRRGCEAP
REPPPPGPLSQHRPAPRRRPLAGQPRKSRSSXRNAWGNLSYADLITKAIESSAEKRLTLS
QIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGG
KSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGSHSN
DDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSLVYPPSAAKMASTLPSLSE
ISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKY
TYGQSSMSPLPQMPMQTLQDNKSSYGGMNQYNCAPGLLKELLTSDSPPHNDIMTPVDPGV
AQPNSRVLGQNVLMGPNSVMPAYGSQASHNKMMTPSSHTHPGHAQSTSAVNGRALPHAVN
TMPHTSGMNRLAQVKTALQVPLPHPMQMNTLGGYSTVSSCNGYGRMGILHQEKLPSDLDG
MFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggccgaagcgcctcaggtggtggagattgacccggacttcgagccgctgccccggccg
cgctcgtgcacctggccgctgcccaggccggagtttagccagtccaactcggccacttcc
agcccggcgccgtcgggcggcgcggccgcgaaccccgacgccgccgcgggcctgccctcg
gcctcggcggccgctgtcaacgccgacttcatgaacaacctgagcctgctggaggagagc
ggagacttccagcaggcacccggttccgtggcggcggccgcggtggtggcggggcggcag
cggcgccgctgctgccacggggggctgggggacttagggcggagggggtgtgaggcgccg
cgcgagcccccgccgcccgggccgctgtcgcagcaccgcccggccccccgccgccggccg
ctcgcagggcagccgcgcaagagccgctcctccncgcgcaacgcgtggggcaacctgtcc
tacgccgacctcatcaccaaggccatcgagagctcggcagagaagcggctcacgctgtcg
cagatctacgagtggatggtcaagagtgtgccctacttcaaggataagggcgacagcaac
agctcggcgggctggaagaattcaattcgtcataatctgtccctacacagcaagttcatt
cgtgtgcagaatgaaggaactggaaaaagttcttggtggatgctcaatcctgagggaggc
aagagtgggaaatcccccagaagaagagccgcatccatggacaataacagtaaatttgct
aagagccgaggccgagctgccaagaaaaaagcatccctgcagtctggccaggagggtgct
ggggatagcccgggatctcagttttctaagtggcctgcaagccctggctctcacagcaat
gatgactttgataactggagtacatttcgacctcgaactagctcgaatgctagtaccatt
agtgggagactttctcctattatgaccgaacaggatgatcttggagatggggatgtgcat
tctctggtatacccaccatctgcagcaaagatggcttctactctgcccagtctgtctgag
ataagcaatcctgagaacatggaaaaccttttggataatctcaaccttctctcatcacca
acatcattaactgtttcaacccagtcttcaccgggcaccatgatgcagcagacaccatgc
tactcatttgcgccgcccaacaccagtctgaattcacccagcccaaactaccaaaaatac
acgtacggccaatccagcatgagccccttgccccagatgcctatgcaaacgcttcaggac
aacaaatcgagttatggcggtatgaatcagtataactgcgcaccgggactcttgaaggag
ttacttacttctgactctcctccccataatgacattatgacaccagttgatcctggggtg
gctcaacccaatagccgggtccttggccagaatgtgttgatgggccctaattcggtcatg
ccagcctatggcagccaggcatctcataacaaaatgatgactcccagctcccacacccac
cctggacatgctcagtccacatctgcagttaacgggcgtgccttgccccatgcggtaaac
accatgccccacacctcgggtatgaaccgtttggcccaggtgaagacagctttacaagtg
cctctgccccaccccatgcagatgaataccctggggggctactccaccgtgagcagctgc
aatggctatggcaggatgggcattctccaccaggagaagctcccgagtgacttggacggc
atgttcatcgagcgcttggactgtgacatggagtccatcattcgaaacgacctcatggat
ggagacacgttggattttaactttgacaatgtgttgcccaaccaaagcttcccccacagt
gtcaagacgacaacacatagctgggtgtcaggctaa

DBGET integrated database retrieval system