Camelus dromedarius (Arabian camel): 105091353 Help Entry 105091353         CDS       T04642                                  Name (RefSeq) C-X-C motif chemokine 6   KO K05506   C-X-C motif chemokine 5/6 Organism cdk  Camelus dromedarius (Arabian camel) Pathway cdk04060   Cytokine-cytokine receptor interaction cdk04061   Viral protein interaction with cytokine and cytokine receptor cdk04062   Chemokine signaling pathway cdk04657   IL-17 signaling pathway cdk04668   TNF signaling pathway cdk05133   Pertussis cdk05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:cdk00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     105091353   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105091353    04061 Viral protein interaction with cytokine and cytokine receptor     105091353  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     105091353    04062 Chemokine signaling pathway     105091353  09160 Human Diseases   09171 Infectious disease: bacterial    05133 Pertussis     105091353   09163 Immune disease    05323 Rheumatoid arthritis     105091353  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cdk04052]     105091353 Cytokines and neuropeptides [BR:cdk04052]  Cytokines   Chemokines    105091353 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  105091353 NCBI-ProteinID:  XP_031326411 LinkDB All DBs Position 2:71793311..71795508 Genome browser AA seq 113 aa AA seqDB search MRLLPSRAARISGPSGSLCALLALLLLTPPGPLASAGPVAAVVRELRCMCLTTNTGVHPK VISNLQVIASGPQCSKVEVIATLKNGQEVCLNPEAPLIRKIIQKMLDSGNKNN NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgagactcctacccagccgcgccgcccgcatctccggcccttcgggctcgctgtgcgcg ctgctcgcgctgctgttgctgacgccgccagggcccctcgccagcgctggtcctgtcgca gccgtagtgagagagttgcgatgcatgtgtttaaccaccaacacgggggttcatccgaaa gtaatcagtaatctgcaggtgatcgcctcaggaccgcagtgctccaaggtggaagtgatt gccaccttgaagaacggacaggaagtctgtctgaacccagaagctcctttgatcaggaaa atcatccagaaaatgctggacagtggaaacaagaataattaa

DBGET integrated database retrieval system