KEGG   Camelus dromedarius (Arabian camel): 105091467
Entry
105091467         CDS       T04642                                 

Gene name
SOS2
Definition
(RefSeq) LOW QUALITY PROTEIN: son of sevenless homolog 2
  KO
K03099  son of sevenless
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk04010  MAPK signaling pathway
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04062  Chemokine signaling pathway
cdk04068  FoxO signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04510  Focal adhesion
cdk04540  Gap junction
cdk04630  JAK-STAT signaling pathway
cdk04650  Natural killer cell mediated cytotoxicity
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04664  Fc epsilon RI signaling pathway
cdk04714  Thermogenesis
cdk04722  Neurotrophin signaling pathway
cdk04810  Regulation of actin cytoskeleton
cdk04910  Insulin signaling pathway
cdk04912  GnRH signaling pathway
cdk04915  Estrogen signaling pathway
cdk04917  Prolactin signaling pathway
cdk04926  Relaxin signaling pathway
cdk04935  Growth hormone synthesis, secretion and action
cdk05034  Alcoholism
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05211  Renal cell carcinoma
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105091467 (SOS2)
   04012 ErbB signaling pathway
    105091467 (SOS2)
   04014 Ras signaling pathway
    105091467 (SOS2)
   04630 JAK-STAT signaling pathway
    105091467 (SOS2)
   04068 FoxO signaling pathway
    105091467 (SOS2)
   04072 Phospholipase D signaling pathway
    105091467 (SOS2)
   04151 PI3K-Akt signaling pathway
    105091467 (SOS2)
   04150 mTOR signaling pathway
    105091467 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105091467 (SOS2)
   04540 Gap junction
    105091467 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105091467 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    105091467 (SOS2)
   04660 T cell receptor signaling pathway
    105091467 (SOS2)
   04662 B cell receptor signaling pathway
    105091467 (SOS2)
   04664 Fc epsilon RI signaling pathway
    105091467 (SOS2)
   04062 Chemokine signaling pathway
    105091467 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105091467 (SOS2)
   04912 GnRH signaling pathway
    105091467 (SOS2)
   04915 Estrogen signaling pathway
    105091467 (SOS2)
   04917 Prolactin signaling pathway
    105091467 (SOS2)
   04926 Relaxin signaling pathway
    105091467 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    105091467 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    105091467 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    105091467 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105091467 (SOS2)
   05206 MicroRNAs in cancer
    105091467 (SOS2)
   05205 Proteoglycans in cancer
    105091467 (SOS2)
   05231 Choline metabolism in cancer
    105091467 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105091467 (SOS2)
   05225 Hepatocellular carcinoma
    105091467 (SOS2)
   05226 Gastric cancer
    105091467 (SOS2)
   05214 Glioma
    105091467 (SOS2)
   05221 Acute myeloid leukemia
    105091467 (SOS2)
   05220 Chronic myeloid leukemia
    105091467 (SOS2)
   05211 Renal cell carcinoma
    105091467 (SOS2)
   05215 Prostate cancer
    105091467 (SOS2)
   05213 Endometrial cancer
    105091467 (SOS2)
   05224 Breast cancer
    105091467 (SOS2)
   05223 Non-small cell lung cancer
    105091467 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    105091467 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    105091467 (SOS2)
   05160 Hepatitis C
    105091467 (SOS2)
   05163 Human cytomegalovirus infection
    105091467 (SOS2)
   05165 Human papillomavirus infection
    105091467 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105091467 (SOS2)
   01522 Endocrine resistance
    105091467 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cdk04990]
    105091467 (SOS2)
Domain-containing proteins not elsewhere classified [BR:cdk04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   105091467 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_19 PH_13
Other DBs
NCBI-GeneID: 105091467
NCBI-ProteinID: XP_031309536
LinkDB
Position
6
AA seq 1227 aa
MQQAPQPYEFFSEENSPKWRGLLVSALRKVQEQVHPNLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIEVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFISDRKLFKPSDI
EKIFSNILDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPKFNEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEHEDRECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQSRLPG
YSSAEYRLKEKFVMRKIQICDKEDTCECKHAFELVSKDENSIIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNVQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
VEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRKILD
EAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKISFSRIAETELESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFDHDASNSKGNMKSDDDPPAIPPRQPPPPKVKPRVPAPTGALMGLC
IVHLHRRREILFLIPLHRFPFGLQNTL
NT seq 3684 nt   +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccttacgagttcttcagcgaagagaacagtccgaaatggcgg
ggactgttggtctcggccctgcgaaaggttcaggagcaagtacatcccaatctctcagct
aatgaagagtctctctattatattgaagagctgatttttcagctgcttaataaattatgc
atggcccaaccaaggactgttcaagatgtggaggaacgagttcaaaaaaccttccctcat
ccaattgataaatgggctattgctgatgcacagtctgccatagagaaacgaaaacgaagg
aatcctctcttactgcctgtggacaaaatccatccttcattgaaggaagttttagggtac
aaagtggactaccacgtgtccctatatattgtggctgtactagagtatatctcagctgat
attttaaaattggctggtaattatgtttttaatatccgacattatgaaatatcccaacag
gacattgaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggcttggtttctctctgtgaagatgaacctagttcttcaggtgaattaaattactat
gaccttgtcagaactgaaattgcagaagaaagacagtatctacgggaactaaatatgatc
ataaaagtgtttcgagaagcttttatttctgaccgaaagctgtttaaaccttctgatatt
gaaaagattttcagtaacattttagatatacatgaactgaccgtgaaacttttaggtttg
attgaagatacagttgaaatgactgatgaaagcagccctcatcccttagctggcagttgt
tttgaagatttggcagaagagcaagcatttgatccctatgaaacattatctcaggatatt
ctttcaccaaaatttaatgaacatttcagtaagttgatggccagacctgcagtggctcta
cactttcagtccattgctgatggttttaaagaggcagttcgttatgtccttccacgcctt
atgctggtgccagtgtatcattgttggcactattttgaattattaaagcaattgaaagca
tgtagtgaagagcacgaagacagagaatgtttgaaccaagctattactgctctaatgaat
ctccaaggtagcatggaccgaatttacaagcagtattcacctagacgccgacctggggat
cccgtttgccctttttataatcgtcaattaagaagcaagcacctggctattaaaaaaatg
aatgaaattcagaaaaacatagatggatgggaaggcaaagatattggacagtgttgtaac
gaatttattatggaaggcccattgacaagaattggtgctaaacatgaacggcatattttt
ctctttgatggcttgatgattagctgcaaacccaatcatagccagtcacgacttccagga
tacagtagtgcagaatacagattaaaagaaaaatttgtcatgaggaaaatacaaatatgt
gataaagaagatacttgtgagtgcaaacacgcctttgaattagtatccaaggatgaaaac
agcataatatttgctgctaagtctgctgaagagaaaaataattggatggcagcacttatt
tctcttcattatcgtagtacccttgatcgaatgctagattcagtattattgaaggaagaa
aatgaacaaccactgagattaccaagtccagaagtgtatcgttttgtggtaaaagactct
gaggaaaacattgtttttgaagacaacgtgcaaagtagaagtggaatccccattattaaa
ggaggaactgtggtgaaattaattgaaaggttaacataccatatgtatgcagatcccaat
tttgttcgtacttttcttactacatatcgttcattttgtaaaccacaggaattgctaagc
ttactaattgaacgatttgaaattccagagccagaacctacagaagcagataaattggca
gtagagaaaggcgagcagccaatcagtgcagaccttaaaaggtttcgcaaggaatacgtc
caaccagtacaacttaggatcttaaatgtgtttcggcactgggttgaacaccatttttat
gactttgaaagagatttggagttgcttgaaagactagaatccttcatttcaagtgtaaga
gggaaagctatgaagaaatgggtagagtcaattgctaagatcatcaagaggaagaaacaa
gctcaggcaaatggaataagccataatattacatttgaaagtccacctccaccaattgaa
tggcatatcagcagaccaggacagtttgaaacatttgatctcatgacacttcatccaata
gaaattgcacgtcaactgacacttttggaatctgatctctacaggaaagtccagccttct
gaacttgtggggagtgtatggaccaaagaagataaagaaataaattctccaaatttatta
aaaatgattcgccacaccacaaatctcaccctctggtttgaaaaatgtattgtggaagca
gaaaattttgaggaacgagtggcagtcctaagtagaattatagaaattcttcaagttttt
caagatttgaataatttcaatggtgtattggaaatcgtcagtgcggtaaattcagtgtca
gtctacagactagatcatacctttgaggcattgcaagaaagaaaaaggaaaattttggat
gaagctgtggaattaagtcaagatcactttaaaaaatatctagtgaaacttaagtcaata
aatccaccttgtgtgccttttttcggaatatatttaacaaatattctgaagaccgaagaa
gggaataatgattttttaaaaaagaaagggaaagatttaatcaatttcagtaagaggagg
aaagtagctgaaattactggagaaattcagcaatatcagaatcaaccttactgtttacgg
atagaaccagaaatgaggaggttctttgaaaaccttaatccaatgggaagtgcttctgaa
aaagagtttacagattatttgttcaacaagtccctagaaattgaaccccgaaactgcaaa
cagccacctcgatttcctagaaaatcgactttctctttaaaatctcctggaataaggcct
aacacaggccgacatggctctacctcaggtactttacgaggtcatccaacaccattagaa
agagaaccatgcaaaataagctttagtcggattgctgaaacagagctggaatcaacagtg
tcagcaccaacctcccccaatacaccgtctactccaccagtatctgcttcttcagacctt
agtgtgtttttagatgtggatctcaacagctcctgtggaagcaatagcatctttgctcca
gttctcttgccacattcaaagtctttcttcagttcgtgtggtagtttacataaactaagt
gaagagccactgattcctcctccacttccgcctcgaaaaaagtttgatcacgatgcttca
aattccaagggaaatatgaaatctgatgatgacccccctgctattccaccaagacaacct
cctcctccaaaggtaaaacccagagttcctgctcctactggtgcattgatgggcctctgc
atagtccacctccaccgccgccgagagatcctcttcctgatacccctccaccggttcccc
ttcggcctccagaacactttataa

KEGG   Camelus dromedarius (Arabian camel): 105103654
Entry
105103654         CDS       T04642                                 

Gene name
SOS1
Definition
(RefSeq) son of sevenless homolog 1 isoform X1
  KO
K03099  son of sevenless
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk04010  MAPK signaling pathway
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04062  Chemokine signaling pathway
cdk04068  FoxO signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04510  Focal adhesion
cdk04540  Gap junction
cdk04630  JAK-STAT signaling pathway
cdk04650  Natural killer cell mediated cytotoxicity
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04664  Fc epsilon RI signaling pathway
cdk04714  Thermogenesis
cdk04722  Neurotrophin signaling pathway
cdk04810  Regulation of actin cytoskeleton
cdk04910  Insulin signaling pathway
cdk04912  GnRH signaling pathway
cdk04915  Estrogen signaling pathway
cdk04917  Prolactin signaling pathway
cdk04926  Relaxin signaling pathway
cdk04935  Growth hormone synthesis, secretion and action
cdk05034  Alcoholism
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05165  Human papillomavirus infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05211  Renal cell carcinoma
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105103654 (SOS1)
   04012 ErbB signaling pathway
    105103654 (SOS1)
   04014 Ras signaling pathway
    105103654 (SOS1)
   04630 JAK-STAT signaling pathway
    105103654 (SOS1)
   04068 FoxO signaling pathway
    105103654 (SOS1)
   04072 Phospholipase D signaling pathway
    105103654 (SOS1)
   04151 PI3K-Akt signaling pathway
    105103654 (SOS1)
   04150 mTOR signaling pathway
    105103654 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105103654 (SOS1)
   04540 Gap junction
    105103654 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105103654 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    105103654 (SOS1)
   04660 T cell receptor signaling pathway
    105103654 (SOS1)
   04662 B cell receptor signaling pathway
    105103654 (SOS1)
   04664 Fc epsilon RI signaling pathway
    105103654 (SOS1)
   04062 Chemokine signaling pathway
    105103654 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105103654 (SOS1)
   04912 GnRH signaling pathway
    105103654 (SOS1)
   04915 Estrogen signaling pathway
    105103654 (SOS1)
   04917 Prolactin signaling pathway
    105103654 (SOS1)
   04926 Relaxin signaling pathway
    105103654 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    105103654 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    105103654 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    105103654 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105103654 (SOS1)
   05206 MicroRNAs in cancer
    105103654 (SOS1)
   05205 Proteoglycans in cancer
    105103654 (SOS1)
   05231 Choline metabolism in cancer
    105103654 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105103654 (SOS1)
   05225 Hepatocellular carcinoma
    105103654 (SOS1)
   05226 Gastric cancer
    105103654 (SOS1)
   05214 Glioma
    105103654 (SOS1)
   05221 Acute myeloid leukemia
    105103654 (SOS1)
   05220 Chronic myeloid leukemia
    105103654 (SOS1)
   05211 Renal cell carcinoma
    105103654 (SOS1)
   05215 Prostate cancer
    105103654 (SOS1)
   05213 Endometrial cancer
    105103654 (SOS1)
   05224 Breast cancer
    105103654 (SOS1)
   05223 Non-small cell lung cancer
    105103654 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    105103654 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    105103654 (SOS1)
   05160 Hepatitis C
    105103654 (SOS1)
   05163 Human cytomegalovirus infection
    105103654 (SOS1)
   05165 Human papillomavirus infection
    105103654 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105103654 (SOS1)
   01522 Endocrine resistance
    105103654 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cdk04990]
    105103654 (SOS1)
Domain-containing proteins not elsewhere classified [BR:cdk04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   105103654 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 105103654
NCBI-ProteinID: XP_031322729
LinkDB
Position
15
AA seq 1333 aa
MQAQQLPYEFFSEENAPKWRGLLVPSLKKVQGQVHPTLESSDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIADIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAGIPI
IKAGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKKFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVTLPHGPRSASVSSISL
TKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKVYSPRYSISD
RTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHSNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccgtacgagtttttcagcgaggagaacgcgcctaagtggcgg
ggactgctggtgccttcgctgaaaaaggtccaggggcaagttcatcccactctcgagtct
agtgatgatgctcttcagtatgttgaagaattaattttgcagttattaaatatgctttgc
caagctcagccccgaagtgcttcagatgtagaggaacgtgttcaaaaaagtttccctcat
ccaattgataagtgggcaatagcagatgcccaatcggctattgaaaagaggaagcgaaga
aaccctttatctctcccagtagaaaaaattcatcctttgttaaaggaggtcttaggttat
aaaattgaccaccaggtttctgtttacatagtagcagtattagaatacatttctgcagac
attttaaaactggtggggaattatgtgcgaaatatacggcattatgaaattacaaaacaa
gatattaaagtggcaatgtgtgccgataaggtattgatggatatgtttcatcaagatgta
gaagatataaatatattatctttaactgatgaagagccttccacctcaggagagcaaact
tactatgatttggtaaaagcatttatggcagaaattcgacagtacataagggaactaaat
ttaattataaaagttttcagagagccctttgtctccaattcaaaactgttttcagctaat
gatgtagaaaatatatttagtcgtatagcagatatacatgaacttagtgtaaaattactg
ggccatatagaagatactgtagaaatgacagatgaaggcagtccccatccattagtagga
agctgctttgaagacttagcagaggaactggcatttgatccatatgaatcatatgctcga
gatattttacgacctggttttcatgatcgtttccttagtcagttatcaaagcctggagcg
gccctctacttgcagtcaataggtgaaggtttcaaagaagctgttcagtatgttttaccc
aggctgcttctagctcctgtttaccactgtctacattactttgaacttttgaagcagtta
gaagaaaagagtgaagatcaagaagacaaggaatgtttgaaacaagctataacagcttta
ctgaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaagcgaagactg
agtgaatctgcatgtcggttttacagtcagcaaatgaaggggaaacaactagcaatcaag
aaaatgaacgaaattcagaagaatattgatggttgggagggaaaagacattggacagtgt
tgcaatgagtttataatggaaggaactcttactcgtgtaggagccaaacatgagagacac
atatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcagccaagactt
cctggtgctagcaatgcagaatatcgtcttaaagaaaagttttttatgagaaaggtacaa
attaatgacaaagatgacaccagtgagtacaagcatgcttttgaaataattttaaaagat
gaaaatagtgttatattttctgccaagtcagctgaagagaagaacaattggatggcagca
ttgatatctttacagtaccggagtacactggaaaggatgcttgatgtgacaatgctacag
gaagagaaggaggagcagatgaggctccctagtgctgatgtttatagatttgcagagcct
gactctgaagaaaatatcatatttgaagaaaacatgcagcccaaagctggaattccaatt
atcaaagcaggaactgttgttaaacttatagagaggctcacataccatatgtacgcagat
cccaattttgttcggacatttcttacaacatatagatcattttgtaaacctcaagaacta
ctgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaagctgatcgc
atagctatagaaaatggagatcagcccttgagtgcagaactaaaaaggtttagaaaagaa
tatatacaacctgtacaactgcgagtattaaacgtatgtcggcactgggtagagcaccac
ttctatgattttgaaagagatgcagatcttttgcagcgaatggaggaatttattggaaca
gtaagaggtaaagcaatgaaaaaatgggttgaatccatcactaaaataatccaaaggaaa
aaaattgcaagagacaatggaccaggtcataatattacatttcagagttcacctcccaca
gttgagtggcatataagcagacctgggcatatagagacttttgacctgctcaccttacat
ccaatagaaattgctcgacaactcactttacttgaatcagatctatatcgagctgtacag
ccatcagaattagtcggaagtgtgtggacaaaagaagacaaagaaattaattctcctaat
cttctgaaaatgatccggcataccactaatctcactctgtggtttgagaaatgtattgta
gaaactgaaaacttagaagaaagagtagcagtggtaagtcgaataattgagattctgcaa
gtctttcaagagctgaacaacttcaatggtgtccttgaggttgtcagtgctatgaactca
tcacctgtttacaggctagaccacacattcgagcaaataccaagccgccaaaagaaaatt
ttagaagaagctcatgaactaagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggaatttatctaactaatatcttgaaaaca
gaagaaggcaaccctgaggtcctgaaaaggcatggaaaagagcttataaactttagcaaa
aggaggaaagtggcagaaataacaggcgagatccagcagtaccaaaatcagccttactgt
ttacgagtagaatcagatatcaaaaagttctttgaaaacttgaatccaatgggaaatagc
atggaaaaagaatttacagattatcttttcaacaaatccctagaaatagaaccacgaaac
cctaaacctctcccgagatttccaaaaaaatatagctaccccctaaaatctcctggtgtt
cgtccatcaaacccaagaccaggtaccatgagacatcccacacctctgcagcaggagcca
aggaaaattagttatagtaggatccctgaaagtgaaacagaaagtacagcatctgcacca
aattctccaagaacaccgttaacacctcctcctgcttctggtgcttctagtaccacagat
gtttgcagcgtatttgattctgatcattcaagcccttttcattcaagcagcgataccgtc
tttatccaagttacactgccccatggcccaagatctgcttcagtatcatctataagttta
actaaaggcactgacgaagtgcctgtcccccctcctgttcctccacgaagacgaccagaa
tctgccccagcggaatcttcgccatctaagattatgtctaagcatttggacagcccccca
gcaattcctcctaggcaacccacatcaaaagtgtattcaccacgatactcaatatcagat
cggacttctatatcagaccctcctgaaagcccacccttactaccaccacgggaacccgtg
aggacacctgatgttttctcaagctcacctctacatctccagcctccccccttgggcaaa
aaaagtgaccatagtaatgccttcttcccaaacagcccttccccctttacaccacctcct
cctcaaacaccttctcctcacggcacgagaaggcatctgccatcaccaccattgacacaa
gaagtggacctgcattccattgctgggccgcctgttcctccacgacaaagcacttctcaa
catatccctaaactcccaccaaaaacttacaaaagggagcacacacacccatccatgcac
agagatggaccaccactgctggagaatgcccattcttcctga

DBGET integrated database retrieval system