KEGG   Camelus dromedarius (Arabian camel): 105091525
Entry
105091525         CDS       T04642                                 

Gene name
FADS2
Definition
(RefSeq) acyl-CoA 6-desaturase
  KO
K10226  acyl-CoA 6-desaturase (Delta-6 desaturase) [EC:1.14.19.3]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00592  alpha-Linolenic acid metabolism
cdk01040  Biosynthesis of unsaturated fatty acids
cdk01100  Metabolic pathways
cdk01212  Fatty acid metabolism
cdk03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    105091525 (FADS2)
   01040 Biosynthesis of unsaturated fatty acids
    105091525 (FADS2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105091525 (FADS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cdk01004]
    105091525 (FADS2)
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     105091525 (FADS2)
Lipid biosynthesis proteins [BR:cdk01004]
 Desaturase
  Front-end
   105091525 (FADS2)
SSDB
Motif
Pfam: FA_desaturase Cyt-b5
Other DBs
NCBI-GeneID: 105091525
NCBI-ProteinID: XP_031315333
LinkDB
Position
10
AA seq 444 aa
MGKGGNQGEGATEREAPMPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSRRHPGGFRVI
GHYAGEDATDAFFAFHRNLDFVRKFMKPLLIGELAPEEPSQDHSKNSQITEDFRALRKTA
EQMNLFKANHLFFLLLLAHIFVMETIAWFTVFYFGNGWIPTIITAIILAASQAQAGWLQH
DFGHLSVYKKSTWNHIVHKFTIGHLKGASGNWWNHRHFQHHAKPNIFQKDPDVNMLHLFV
LGERQPVEYGQKKLKYLPYNHQHEYFYLIGPPLLIPIYFQYQIIMTMIVHKDWVDLAWAV
SYYARFFITYIPFYGFLGSILFLNFIRFLESHWFVWVTQMSHIPMDIDNEAYRDWFSSQL
SATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKVAPLVRSLCAKHGIEYQEKPLL
QALQDITGSLKKSGQLWLDAYLHK
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggggaagggggggaaccagggcgaaggggctaccgagcgcgaggcgccgatgcctacc
ttcagctgggaggagattcagaagcacaacctgcgaacggacaggtggctcgtcatcgac
cgcaaagtctacaacatcaccaaatggtccagacggcatccggggggctttcgggtcatc
gggcactacgcaggggaagatgctacggatgccttcttcgccttccaccgcaaccttgat
ttcgtgcgcaagttcatgaagcccttgctgatcggtgagctggccccggaggagcccagc
caggaccacagcaagaactcgcagatcactgaggacttccgggccctgaggaagactgct
gagcagatgaacctgttcaaggccaaccacctgttcttcctcctcctcctggcccacatc
ttcgtcatggagaccattgcgtggttcaccgtcttctactttggcaatggctggattcca
acgatcattacggccattattcttgctgcctctcaggcccaagctggatggctgcaacac
gattttggccacctctctgtttacaagaagtccacgtggaaccacatcgtccacaagttc
accataggccacttaaagggtgcctctggcaactggtggaaccatcgccacttccagcat
catgccaagcccaacatcttccagaaggatccagatgtgaacatgctgcatttgtttgtc
ctgggagaacggcagcccgttgagtacggccagaagaagctgaaatacctgccttacaac
caccagcacgagtacttctacctgattgggccgcccctgctcatccccatatacttccag
taccagatcatcatgaccatgattgttcacaaagactgggtggacttggcctgggccgtc
agctactatgcccgtttcttcatcacttacatccctttctatggtttcctgggatccatc
cttttcctcaacttcatcaggttcttggagagccactggtttgtatgggtcacgcagatg
agccacatccccatggatattgacaacgaggcctatcgtgactggttcagcagccagctg
tcggccacctgcaacgtggagcagtccttcttcaacgactggttcagcgggcacctcaac
ttccagatcgagcaccacctcttccccactatgccccggcacaacttgcacaaggtcgcc
ccgctggtgaggtccttgtgcgccaaacacggcatcgagtaccaggagaagccgctgctg
caggccctgcaggacatcactgggtccctgaagaagtctgggcagctgtggctggacgcc
tatctccacaaatga

KEGG   Camelus dromedarius (Arabian camel): 105104977
Entry
105104977         CDS       T04642                                 

Definition
(RefSeq) acyl-CoA 6-desaturase-like
  KO
K10226  acyl-CoA 6-desaturase (Delta-6 desaturase) [EC:1.14.19.3]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00592  alpha-Linolenic acid metabolism
cdk01040  Biosynthesis of unsaturated fatty acids
cdk01100  Metabolic pathways
cdk01212  Fatty acid metabolism
cdk03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    105104977
   01040 Biosynthesis of unsaturated fatty acids
    105104977
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    105104977
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cdk01004]
    105104977
Enzymes [BR:cdk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     105104977
Lipid biosynthesis proteins [BR:cdk01004]
 Desaturase
  Front-end
   105104977
SSDB
Motif
Pfam: Cyt-b5 EpuA
Other DBs
NCBI-GeneID: 105104977
NCBI-ProteinID: XP_010997037
LinkDB
Position
6
AA seq 242 aa
MQHGEGGNQGEGAIEREAPMPTFSWEEIQKHNLCTDRWLVIDHKVYNITKWSSRHPRGFR
VIGHYAGEGATDAFLAFHRNLSFVLKFMKPLLIGDLAPEEPSQDHSKNLQITEDFRALRK
TTEEMNLFKTNHLFFLLLLAHIFIMETITWFTVFYFGNGWIPIIIMAFILAASQAPAGWL
QHDFGHLSVYKKSTWNHIVHKFTIGHLKVTVSHPGCPSHQLAFDAALSHFTLRPGPTNPP
LL
NT seq 729 nt   +upstreamnt  +downstreamnt
atgcagcatggggaaggggggaaccagggcgagggggctatcgagcgcgaggcgccgatg
cctaccttcagctgggaggagattcagaagcacaacctgtgcacggacaggtggctcgtc
atcgaccacaaagtctacaacatcaccaaatggtccagccggcatccacggggctttcgg
gtcatcgggcactacgcaggggaaggtgctacggacgccttcctcgccttccaccgcaac
ctcagtttcgtgctcaagttcatgaagcctttgctgatcggtgatctggccccggaggag
cccagccaggaccacagcaagaacttgcagatcactgaggacttccgggccctgaggaag
accactgaggagatgaacctgttcaagaccaaccacctgttcttcctcctcctcctggcc
cacatcttcatcatggagaccatcacgtggttcactgtcttttattttggcaatggctgg
attccaatcatcattatggcctttattcttgctgcctctcaggccccagctggatggctg
caacacgattttggccacctctctgtttacaagaagtctacgtggaaccacattgtccac
aagttcaccattggccacttaaaggtaactgtcagccaccctgggtgtccgtcccatcag
ttagcgtttgatgcagcactatctcactttactctgagaccaggacctaccaatcccccg
cttctctga

DBGET integrated database retrieval system