KEGG   Camelus dromedarius (Arabian camel): 105091663
Entry
105091663         CDS       T04642                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk04010  MAPK signaling pathway
cdk04012  ErbB signaling pathway
cdk04015  Rap1 signaling pathway
cdk04024  cAMP signaling pathway
cdk04062  Chemokine signaling pathway
cdk04068  FoxO signaling pathway
cdk04150  mTOR signaling pathway
cdk04270  Vascular smooth muscle contraction
cdk04510  Focal adhesion
cdk04650  Natural killer cell mediated cytotoxicity
cdk04720  Long-term potentiation
cdk04722  Neurotrophin signaling pathway
cdk04726  Serotonergic synapse
cdk04730  Long-term depression
cdk04810  Regulation of actin cytoskeleton
cdk04910  Insulin signaling pathway
cdk04914  Progesterone-mediated oocyte maturation
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04934  Cushing syndrome
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05034  Alcoholism
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05210  Colorectal cancer
cdk05211  Renal cell carcinoma
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05216  Thyroid cancer
cdk05218  Melanoma
cdk05219  Bladder cancer
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105091663 (BRAF)
   04012 ErbB signaling pathway
    105091663 (BRAF)
   04015 Rap1 signaling pathway
    105091663 (BRAF)
   04068 FoxO signaling pathway
    105091663 (BRAF)
   04024 cAMP signaling pathway
    105091663 (BRAF)
   04150 mTOR signaling pathway
    105091663 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105091663 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105091663 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    105091663 (BRAF)
   04062 Chemokine signaling pathway
    105091663 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105091663 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    105091663 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    105091663 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    105091663 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    105091663 (BRAF)
   04720 Long-term potentiation
    105091663 (BRAF)
   04730 Long-term depression
    105091663 (BRAF)
   04722 Neurotrophin signaling pathway
    105091663 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105091663 (BRAF)
   05205 Proteoglycans in cancer
    105091663 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105091663 (BRAF)
   05212 Pancreatic cancer
    105091663 (BRAF)
   05225 Hepatocellular carcinoma
    105091663 (BRAF)
   05226 Gastric cancer
    105091663 (BRAF)
   05214 Glioma
    105091663 (BRAF)
   05216 Thyroid cancer
    105091663 (BRAF)
   05221 Acute myeloid leukemia
    105091663 (BRAF)
   05220 Chronic myeloid leukemia
    105091663 (BRAF)
   05218 Melanoma
    105091663 (BRAF)
   05211 Renal cell carcinoma
    105091663 (BRAF)
   05219 Bladder cancer
    105091663 (BRAF)
   05215 Prostate cancer
    105091663 (BRAF)
   05213 Endometrial cancer
    105091663 (BRAF)
   05224 Breast cancer
    105091663 (BRAF)
   05223 Non-small cell lung cancer
    105091663 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105091663 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    105091663 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    105091663 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105091663 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    105091663 (BRAF)
   05160 Hepatitis C
    105091663 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105091663 (BRAF)
   01522 Endocrine resistance
    105091663 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105091663 (BRAF)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105091663 (BRAF)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   105091663 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 105091663
NCBI-ProteinID: XP_031311352
LinkDB
Position
7
AA seq 778 aa
MAALSGGGGAEQGQALFNGDMEPEAGAAASSAADPAIPEEVWNIKQMIKLTQEHIEALLD
KFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTSSSSS
SLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALM
MRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLA
FCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEEAS
LAETALTSGSSSSAPPSDSIGPPILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSA
PNVHINTIEPVNIDDLIRDQGFRSDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRER
KSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLN
VTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIET
KFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSG
SHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQII
FMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQERSRRKYRLFNSGYPWK
ILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2337 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggcggtggcggcgcggagcagggccaggctctgttcaacggggac
atggagcccgaggccggcgctgcggcctcttcggctgcggaccctgccattcccgaggag
gtgtggaatatcaaacaaatgattaagttgacacaggaacatatagaggccctattggac
aaatttggtggggagcataatccaccatcaatatatctggaggcctatgaagaatacacc
agcaagctagatgccctccaacaaagagaacaacagttattggaatccctggggaatgga
actgatttttctgtttctagctctgcatcaacggacaccgttacatcttcttcctcttct
agcctttcagtgctgccttcatctctttcagtttttcaaaaccccacagatgtgtcacgg
agcaaccccaagtcaccacaaaaacctatcgttagagtcttcctgcccaataaacagagg
acagtggtacctgcaaggtgtggagttacagttcgggacagtctaaagaaagcactgatg
atgagaggtctaatcccagagtgctgtgctgtttacagaattcaggatggagagaagaaa
ccaattggctgggatactgatatttcctggcttaccggagaggaattgcatgtagaagtg
ttggagaatgttccacttacaacacacaactttgtacggaaaacttttttcaccttagca
ttttgtgacttctgtcgaaagctgcttttccaggggttccgctgtcaaacatgtggttat
aaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaattatgaccaactt
gatttgctgtttgtctccaagttctttgaacaccacccaataccacaggaggaggcctcc
ttagcagagactgcccttacgtctgggtcatcctcgtctgcacccccctccgattctatt
gggcccccaattctcaccagtccgtctccttcaaaatccattccaattccacagcctttc
cgaccagcagatgaagatcatcgaaatcagtttggacaacgagaccggtcctcgtcagct
ccaaatgtgcatataaacacaatagaacccgtcaatattgatgacttgattagagaccaa
gggtttcgtagtgatggaggatccaccacaggtttgtctgccacaccccctgcctcatta
cctggctcactcactaatgtgaaagcattacagaaatctccaggacctcagcgagaaagg
aaatcatcttcatcctcagaagacagaaatcgaatgaaaacacttggtagacgggattca
agtgacgattgggagattcctgatgggcagatcacggtgggacaaagaattggatccggg
tcgtttgggacagtctacaagggaaagtggcatggtgatgtggcagtgaaaatgttgaat
gtgacagcacccacacctcagcagttacaggccttcaaaaatgaagtaggagtactcagg
aaaactcgacatgtgaatatcctactcttcatgggttattcaacaaagccacaactggct
attgttacccagtggtgtgagggctccagcttatatcatcatctccacatcattgagacc
aaattcgagatgatcaaacttatagatattgcacggcagactgcacagggcatggattac
ttacacgccaagtcaatcatccacagagacctcaagagtaataatatttttcttcatgaa
gacctcacagtaaaaataggtgactttggtctagccacagtgaaatctcgatggagtggg
tcccatcagtttgaacaattgtctggatccattttgtggatggcaccagaagtaatcaga
atgcaagataaaaacccatatagctttcaatcagatgtgtatgcatttgggattgttctg
tatgaattgatgactggacagttaccttattcaaacatcaacaacagagaccagataatt
tttatggtgggacgaggatatctgtctccagatctcagtaaggtacggagtaactgtcca
aaagccatgaagagattaatggcagagtgcctaaaaaagaaaagagatgagagaccactc
tttccccaagaaaggtccagaagaaagtatagactctttaacagtggttacccctggaag
attctcgcctctattgagctgctggcccgctcattgccaaaaattcaccgcagtgcatca
gaaccctccttgaatcgggctggcttccagacagaggattttagtctgtatgcttgtgct
tctccaaaaacacccatccaagcagggggatatggagaatttgcagccttcaagtag

KEGG   Camelus dromedarius (Arabian camel): 105093099
Entry
105093099         CDS       T04642                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk04010  MAPK signaling pathway
cdk04012  ErbB signaling pathway
cdk04014  Ras signaling pathway
cdk04015  Rap1 signaling pathway
cdk04022  cGMP-PKG signaling pathway
cdk04024  cAMP signaling pathway
cdk04062  Chemokine signaling pathway
cdk04068  FoxO signaling pathway
cdk04071  Sphingolipid signaling pathway
cdk04072  Phospholipase D signaling pathway
cdk04140  Autophagy - animal
cdk04150  mTOR signaling pathway
cdk04151  PI3K-Akt signaling pathway
cdk04210  Apoptosis
cdk04218  Cellular senescence
cdk04270  Vascular smooth muscle contraction
cdk04360  Axon guidance
cdk04370  VEGF signaling pathway
cdk04371  Apelin signaling pathway
cdk04510  Focal adhesion
cdk04540  Gap junction
cdk04550  Signaling pathways regulating pluripotency of stem cells
cdk04613  Neutrophil extracellular trap formation
cdk04625  C-type lectin receptor signaling pathway
cdk04630  JAK-STAT signaling pathway
cdk04650  Natural killer cell mediated cytotoxicity
cdk04660  T cell receptor signaling pathway
cdk04662  B cell receptor signaling pathway
cdk04664  Fc epsilon RI signaling pathway
cdk04666  Fc gamma R-mediated phagocytosis
cdk04720  Long-term potentiation
cdk04722  Neurotrophin signaling pathway
cdk04726  Serotonergic synapse
cdk04730  Long-term depression
cdk04810  Regulation of actin cytoskeleton
cdk04910  Insulin signaling pathway
cdk04912  GnRH signaling pathway
cdk04914  Progesterone-mediated oocyte maturation
cdk04915  Estrogen signaling pathway
cdk04916  Melanogenesis
cdk04917  Prolactin signaling pathway
cdk04919  Thyroid hormone signaling pathway
cdk04921  Oxytocin signaling pathway
cdk04926  Relaxin signaling pathway
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk04929  GnRH secretion
cdk04935  Growth hormone synthesis, secretion and action
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05034  Alcoholism
cdk05132  Salmonella infection
cdk05152  Tuberculosis
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05163  Human cytomegalovirus infection
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05170  Human immunodeficiency virus 1 infection
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05206  MicroRNAs in cancer
cdk05210  Colorectal cancer
cdk05211  Renal cell carcinoma
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05219  Bladder cancer
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
cdk05230  Central carbon metabolism in cancer
cdk05231  Choline metabolism in cancer
cdk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105093099 (RAF1)
   04012 ErbB signaling pathway
    105093099 (RAF1)
   04014 Ras signaling pathway
    105093099 (RAF1)
   04015 Rap1 signaling pathway
    105093099 (RAF1)
   04370 VEGF signaling pathway
    105093099 (RAF1)
   04371 Apelin signaling pathway
    105093099 (RAF1)
   04630 JAK-STAT signaling pathway
    105093099 (RAF1)
   04068 FoxO signaling pathway
    105093099 (RAF1)
   04072 Phospholipase D signaling pathway
    105093099 (RAF1)
   04071 Sphingolipid signaling pathway
    105093099 (RAF1)
   04024 cAMP signaling pathway
    105093099 (RAF1)
   04022 cGMP-PKG signaling pathway
    105093099 (RAF1)
   04151 PI3K-Akt signaling pathway
    105093099 (RAF1)
   04150 mTOR signaling pathway
    105093099 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105093099 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    105093099 (RAF1)
   04218 Cellular senescence
    105093099 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105093099 (RAF1)
   04540 Gap junction
    105093099 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    105093099 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105093099 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    105093099 (RAF1)
   04625 C-type lectin receptor signaling pathway
    105093099 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    105093099 (RAF1)
   04660 T cell receptor signaling pathway
    105093099 (RAF1)
   04662 B cell receptor signaling pathway
    105093099 (RAF1)
   04664 Fc epsilon RI signaling pathway
    105093099 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    105093099 (RAF1)
   04062 Chemokine signaling pathway
    105093099 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105093099 (RAF1)
   04929 GnRH secretion
    105093099 (RAF1)
   04912 GnRH signaling pathway
    105093099 (RAF1)
   04915 Estrogen signaling pathway
    105093099 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    105093099 (RAF1)
   04917 Prolactin signaling pathway
    105093099 (RAF1)
   04921 Oxytocin signaling pathway
    105093099 (RAF1)
   04926 Relaxin signaling pathway
    105093099 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    105093099 (RAF1)
   04919 Thyroid hormone signaling pathway
    105093099 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    105093099 (RAF1)
   04916 Melanogenesis
    105093099 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    105093099 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    105093099 (RAF1)
   04720 Long-term potentiation
    105093099 (RAF1)
   04730 Long-term depression
    105093099 (RAF1)
   04722 Neurotrophin signaling pathway
    105093099 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    105093099 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105093099 (RAF1)
   05206 MicroRNAs in cancer
    105093099 (RAF1)
   05205 Proteoglycans in cancer
    105093099 (RAF1)
   05230 Central carbon metabolism in cancer
    105093099 (RAF1)
   05231 Choline metabolism in cancer
    105093099 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105093099 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105093099 (RAF1)
   05212 Pancreatic cancer
    105093099 (RAF1)
   05225 Hepatocellular carcinoma
    105093099 (RAF1)
   05226 Gastric cancer
    105093099 (RAF1)
   05214 Glioma
    105093099 (RAF1)
   05221 Acute myeloid leukemia
    105093099 (RAF1)
   05220 Chronic myeloid leukemia
    105093099 (RAF1)
   05218 Melanoma
    105093099 (RAF1)
   05211 Renal cell carcinoma
    105093099 (RAF1)
   05219 Bladder cancer
    105093099 (RAF1)
   05215 Prostate cancer
    105093099 (RAF1)
   05213 Endometrial cancer
    105093099 (RAF1)
   05224 Breast cancer
    105093099 (RAF1)
   05223 Non-small cell lung cancer
    105093099 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105093099 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    105093099 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    105093099 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105093099 (RAF1)
   05152 Tuberculosis
    105093099 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    105093099 (RAF1)
   05161 Hepatitis B
    105093099 (RAF1)
   05160 Hepatitis C
    105093099 (RAF1)
   05164 Influenza A
    105093099 (RAF1)
   05163 Human cytomegalovirus infection
    105093099 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105093099 (RAF1)
   05165 Human papillomavirus infection
    105093099 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105093099 (RAF1)
   01522 Endocrine resistance
    105093099 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105093099 (RAF1)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105093099 (RAF1)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   105093099 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 105093099
NCBI-ProteinID: XP_031326793
LinkDB
Position
17
AA seq 648 aa
MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTLGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
TTSSPSSEGSLSQRQRSTSTPNVHMVSTALPVDSRAIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSSRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacaaggggcctggaagacgatcagcaatggttttggattcaaagatgcg
gtgtttgatggctccagctgcatctcccctacaatagttcagcagtttggctatcagcgt
cgggcatcagatgatggcaaactcacggattcttctaagacaagcaacactatccgtgtt
tttttgccaaacaagcaaagaacagtggtcaatgtgcggaacggaatgagcctgcacgat
tgccttatgaaagctctcaaggtgcggggcctgcaaccagagtgctgtgcagtgttcaga
cttctccacgaacacaagggtaaaaaagcacgtttagattggaatactgatgctgcctcg
ctgattggagaggaacttcaagtagatttcctggatcatgttcccctcacaacacacaac
tttgctcggaagaccttcctgaagcttgccttctgtgatatctgtcagaagttcctgctc
aatggatttcgatgtcagacttgtggctacaaatttcatgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaacatcaggcaactcttattgtttccaaattcaact
ctcggtgacagtggggtcccagcactgccctccttgacgatgcgtcggatgcgagagtct
gtttcccggatgcctgttagttcccagcacagatattccacaccccacgctttcacattc
accacctccagcccctcttctgaaggttccctctcccagaggcagaggtcgacgtctacg
cctaacgtccacatggtcagcaccgccctgcctgtggacagcagggcgatcgaggatgca
attcgaagccacagtgaatcagcctcaccttcagccttgtccagcagccccaacaatctg
agcccaacaggctggtcacagcccaaaacccctgtgccggcacagagagagcgggcacca
ggatccgggacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctat
tactgggaaatagaagccagtgaagtgatgctctccactcggattgggtcaggctccttt
ggaactgtttataagggcaagtggcatggagatgttgcagtaaagatcctcaaggttgtg
gaccccaccccagagcagttccaggccttcaggaatgaggtggctgtccttcgcaaaaca
cggcacgtgaacatcctgctcttcatgggctacatgacaaaggacaacctggccattgtg
acccagtggtgcgagggcagcagcctctacaaacacctgcatgtgcaggagaccaagttc
cagatgttccagttgattgacatcgcccggcagacggctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggcctg
acggtgaaaattggagatttcggtttggcaacagtcaagtcacgctggagtggttctcag
caggttgaacaacccactggctccatcctgtggatggccccagaggtgatccgaatgcag
gataataacccgttcagcttccagtctgacgtctactcctacggcatcgtgctgtacgag
ctcatgaccggcgagctcccttactcccacatcaacaaccgcgaccagatcatcttcatg
gtgggccgagggtacgcctcccccgacctcagcaagctgtacaagaactgccccaaagcg
atgaagaggctggtggccgactgtgtgaagaaagtcaaggaggagaggcctctgtttccc
cagatcctgtcttccatcgaactgctgcagcactctctgccgaaaatcaaccggagcgct
tctgagccatccctgcaccgggcggcccacaccgaggacatcaacgcctgcacgctgacc
acgtcctctaggctgcccgtcttctag

KEGG   Camelus dromedarius (Arabian camel): 105102848
Entry
105102848         CDS       T04642                                 

Gene name
ARAF
Definition
(RefSeq) serine/threonine-protein kinase A-Raf isoform X1
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk01521  EGFR tyrosine kinase inhibitor resistance
cdk01522  Endocrine resistance
cdk04010  MAPK signaling pathway
cdk04012  ErbB signaling pathway
cdk04068  FoxO signaling pathway
cdk04270  Vascular smooth muscle contraction
cdk04650  Natural killer cell mediated cytotoxicity
cdk04720  Long-term potentiation
cdk04726  Serotonergic synapse
cdk04730  Long-term depression
cdk04810  Regulation of actin cytoskeleton
cdk04910  Insulin signaling pathway
cdk04914  Progesterone-mediated oocyte maturation
cdk04928  Parathyroid hormone synthesis, secretion and action
cdk05010  Alzheimer disease
cdk05022  Pathways of neurodegeneration - multiple diseases
cdk05034  Alcoholism
cdk05160  Hepatitis C
cdk05161  Hepatitis B
cdk05200  Pathways in cancer
cdk05205  Proteoglycans in cancer
cdk05210  Colorectal cancer
cdk05211  Renal cell carcinoma
cdk05212  Pancreatic cancer
cdk05213  Endometrial cancer
cdk05214  Glioma
cdk05215  Prostate cancer
cdk05218  Melanoma
cdk05219  Bladder cancer
cdk05220  Chronic myeloid leukemia
cdk05221  Acute myeloid leukemia
cdk05223  Non-small cell lung cancer
cdk05224  Breast cancer
cdk05225  Hepatocellular carcinoma
cdk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105102848 (ARAF)
   04012 ErbB signaling pathway
    105102848 (ARAF)
   04068 FoxO signaling pathway
    105102848 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105102848 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    105102848 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105102848 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    105102848 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    105102848 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    105102848 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    105102848 (ARAF)
   04720 Long-term potentiation
    105102848 (ARAF)
   04730 Long-term depression
    105102848 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105102848 (ARAF)
   05205 Proteoglycans in cancer
    105102848 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105102848 (ARAF)
   05212 Pancreatic cancer
    105102848 (ARAF)
   05225 Hepatocellular carcinoma
    105102848 (ARAF)
   05226 Gastric cancer
    105102848 (ARAF)
   05214 Glioma
    105102848 (ARAF)
   05221 Acute myeloid leukemia
    105102848 (ARAF)
   05220 Chronic myeloid leukemia
    105102848 (ARAF)
   05218 Melanoma
    105102848 (ARAF)
   05211 Renal cell carcinoma
    105102848 (ARAF)
   05219 Bladder cancer
    105102848 (ARAF)
   05215 Prostate cancer
    105102848 (ARAF)
   05213 Endometrial cancer
    105102848 (ARAF)
   05224 Breast cancer
    105102848 (ARAF)
   05223 Non-small cell lung cancer
    105102848 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105102848 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    105102848 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    105102848 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    105102848 (ARAF)
   05160 Hepatitis C
    105102848 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105102848 (ARAF)
   01522 Endocrine resistance
    105102848 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdk01001]
    105102848 (ARAF)
Enzymes [BR:cdk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105102848 (ARAF)
Protein kinases [BR:cdk01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   105102848 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal APH C1_2 TUG-UBL1 Kdo
Other DBs
NCBI-GeneID: 105102848
NCBI-ProteinID: XP_031301182
LinkDB
Position
X
AA seq 611 aa
MEPSRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCRKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRQQFYHSVQDLSGGSRQHETPSSRPLNEPL
TPQGPSLSPASSCSQHRDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSSLIQLT
AQSFNTDAAGNRGGGDGAPRGSPGPASVSSGRKSPHSKSPSEQRERKPLADDKKKVKNLG
YRDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEM
QVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQ
GMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAA
EVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKIS
SNCPKAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELP
ACLLSAARLVP
NT seq 1836 nt   +upstreamnt  +downstreamnt
atggagccatcgcggggcccccctgccaacggggccgagccgtcccgggcagtgggcacc
gtcaaagtgtacctgcccaacaagcaacgcacggtggtgactgtccgggatggcatgagt
gtttacgactctctagacaaggccctcaaggtgcggggtctcaatcaggattgctgtgtg
gtctaccggctcatcaaggggcgaaagacagtcactgcctgggacacggccattgccccc
ctggatggcgaggagctcatcgtggaggtcctcgaagacgtcccgctgaccatgcacaat
tttgtacggaagacgttcttcagcctggcattttgtgacttctgccgtaagtttctgttc
catggcttccgctgccaaacctgtggatacaagttccaccagcattgttcctccaaggtc
cccacagtctgtgtcgacatgagtaccaaccgccaacagttctaccacagtgtccaggat
ttgtccggaggctccagacagcatgagactccctcgagccgccccctgaatgagccgcta
acccctcagggtcccagcctttcccccgccagctcctgctcccagcaccgcgaccccgag
cacttccccttccctgccccggccaacgctcccctccagcgcatccgctccacgtccacc
cccaacgtccatatggtcagcaccacagcccccatggactccagcctcatccagctcact
gcccagagtttcaacaccgatgctgctggtaatagaggtggtggcgatggagctccccgg
gggagccctggcccggccagcgtgtcctcggggaggaagtccccacattccaagtcccct
tcagagcagcgggaacggaaacccttggccgacgacaagaagaaagtgaagaatctcggg
taccgggactcgggctattactgggaggtgccacccagtgaggtgcagctgctgaagagg
atcgggacgggctcgtttggcaccgtgtttcgcgggcggtggcatggtgatgtggccgtg
aaggtgctcaaggtggcccaacccacagctgagcaggcccaggccttcaagaacgagatg
caggtgctcaggaagacccggcacgtcaacatcttgctgttcatgggcttcatgacccgg
ccgggatttgccatcatcacacagtggtgcgagggctccagtctctaccaccacctgcat
gtggccgacacgcgcttcgacatggtccagctcattgatgtggcccggcagacggcccag
ggcatggactacctccatgccaagaacatcatccaccgagatctcaagtctaacaacatc
ttcctacatgaggggctcacggtgaagatcggggactttggcttggccacagtgaagacg
cggtggagcggggcccagcccttggagcagccctcgggctcggtgctgtggatggcggct
gaggtgatccgtatgcaggacccaaacccctacagcttccagtcggatgtctacgcctat
ggggttgtgctctacgagctcatgaccggctcactgccttacagccacattggcagccgt
gaccagattatctttatggtgggccgtggctatctgtccccggacctcagcaaaatctcc
agcaactgccccaaggccatgcggcgcctcctgtctgattgcctcaagttccaacgggag
gagcggcctctcttcccccagatcctggccacgattgagctgctgcagcggtcactcccc
aagattgagcggagtgcctccgaaccctccttgcaccgtacccaggctgatgagttgcct
gcctgcctactcagcgcagcccgccttgtgccttag

DBGET integrated database retrieval system