KEGG   Camelus dromedarius (Arabian camel): 105091843Help
Entry
105091843         CDS       T04642                                 

Gene name
RIBC2
Definition
(RefSeq) RIB43A domain with coiled-coils 2
Organism
cdk  Camelus dromedarius (Arabian camel)
SSDB OrthologParalogGFIT
Motif
Pfam: RIB43A
Motif
Other DBs
NCBI-GeneID: 105091843
NCBI-ProteinID: XP_010981728
LinkDB All DBs
Position
Un
AA seq 377 aa AA seqDB search
MEVVQPKDLEKYYGLAKRSHAELCRQKRIFNARNRIIGGDTEAWDAQVCDQKIKEATEKA
RQETFAAEMRQNDKIKCILENRERRDRKNLCKAISDFQQSFQKPESRREFDLSDPLALKK
DLPAWQSDLHARNTISGMQKFMGEDLNSHERKKFQQEQNREWSLQQQREWKIAQADQKCA
EDLYMKTRLQFDETAKHLQTLESTTRKAVCAAVKEFNKSQALESVEKKIQEKKQEQEDNL
AEISSLLRGDLLSENPQQAASSFGPHRVVPDRWKGMTQEQLEQIRLIQKQQVQEKLRLQE
EERQRDMDWDQRRFQRARTSLLLERQRQRQQRDLRRALDCSNLSLAKEQLLQRKYMKDVC
TNHPTEDYFTQFNTSSR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaggtagtgcaacccaaggacctggagaagtactatggcctggccaaaaggagtcat
gcggagctgtgcagacagaaacgaatcttcaatgccaggaacaggatcattgggggtgac
acagaagcctgggatgctcaggtttgtgaccagaagataaaagaagctactgaaaaagct
agacaggaaacctttgctgctgaaatgaggcaaaatgacaagatcaagtgcatattagaa
aaccgggaaaggagagataggaaaaatctctgtaaagctatcagtgacttccaacagagc
ttccagaagccagaaagtcgccgtgaatttgacctctctgaccccctcgcccttaagaaa
gatcttccagcctggcagtcagatctccatgctcggaatacaatatcagggatgcagaaa
ttcatgggagaggatttaaactcccacgagaggaagaaattccaacaggaacaaaacaga
gaatggtccttgcaacagcaaagggaatggaagattgcccaggccgaccaaaaatgcgca
gaggacctctacatgaagacaaggctgcagtttgacgaaactgccaagcatttacagact
ctggaaagcaccacaagaaaggcggtttgtgccgctgtgaaagaattcaacaagagccag
gccttggagtcagtggaaaagaaaattcaagagaaaaaacaagaacaagaggacaatctg
gccgagatctccagcctgctgcgaggggacctgctctcggagaacccgcagcaggctgcc
agctccttcgggccccatcgcgtggtccccgaccgctggaagggcatgacgcaggagcag
ctggagcagatccgcctgattcagaaacagcaagtccaggagaagctgaggctccaggaa
gaagagcgccagcgagacatggactgggaccagcggaggtttcagagggctcgcaccagc
ttgctgttggagcgccagcggcagcgccagcagcgtgacctgcgcagagccctggactgc
agcaacctcagcctggccaaggagcagctcctgcagagaaaatacatgaaggatgtctgt
acaaatcatcccactgaagattatttcacacaatttaatacaagcagtcgttaa

DBGET integrated database retrieval system