KEGG   Camelus dromedarius (Arabian camel): 105091909
Entry
105091909         CDS       T04642                                 

Gene name
EP300
Definition
(RefSeq) histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04024  cAMP signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04068  FoxO signaling pathway
cdk04110  Cell cycle
cdk04310  Wnt signaling pathway
cdk04330  Notch signaling pathway
cdk04350  TGF-beta signaling pathway
cdk04520  Adherens junction
cdk04630  JAK-STAT signaling pathway
cdk04720  Long-term potentiation
cdk04916  Melanogenesis
cdk04919  Thyroid hormone signaling pathway
cdk04922  Glucagon signaling pathway
cdk04935  Growth hormone synthesis, secretion and action
cdk05016  Huntington disease
cdk05152  Tuberculosis
cdk05161  Hepatitis B
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05206  MicroRNAs in cancer
cdk05211  Renal cell carcinoma
cdk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105091909 (EP300)
   04330 Notch signaling pathway
    105091909 (EP300)
   04350 TGF-beta signaling pathway
    105091909 (EP300)
   04630 JAK-STAT signaling pathway
    105091909 (EP300)
   04066 HIF-1 signaling pathway
    105091909 (EP300)
   04068 FoxO signaling pathway
    105091909 (EP300)
   04024 cAMP signaling pathway
    105091909 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105091909 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    105091909 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    105091909 (EP300)
   04935 Growth hormone synthesis, secretion and action
    105091909 (EP300)
   04919 Thyroid hormone signaling pathway
    105091909 (EP300)
   04916 Melanogenesis
    105091909 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    105091909 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105091909 (EP300)
   05206 MicroRNAs in cancer
    105091909 (EP300)
   05203 Viral carcinogenesis
    105091909 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    105091909 (EP300)
   05215 Prostate cancer
    105091909 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    105091909 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    105091909 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105091909 (EP300)
   05161 Hepatitis B
    105091909 (EP300)
   05164 Influenza A
    105091909 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105091909 (EP300)
   05165 Human papillomavirus infection
    105091909 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105091909 (EP300)
   03036 Chromosome and associated proteins [BR:cdk03036]
    105091909 (EP300)
   03029 Mitochondrial biogenesis [BR:cdk03029]
    105091909 (EP300)
Enzymes [BR:cdk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     105091909 (EP300)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    105091909 (EP300)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    105091909 (EP300)
Mitochondrial biogenesis [BR:cdk03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    105091909 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 105091909
NCBI-ProteinID: XP_010981827
LinkDB
Position
12
AA seq 2419 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQPQQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPAPSAPGMMNSPVNQPAMGMNTGMNAGMNPGMLT
AGNGQGMMPNQVMNGSIGAGRGRPNMQYPNPGMGSAGNLMTEPLQQGSPQMGGQTGLRGP
QPLKMGMMNNPNPYSSPYTQNSGQQIGTSGLGLQIPTKSVLPNSLPPFAMDKKAVPGGGM
PNMGQQQSPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKNQQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQTSNLLSDSMLHSAINS
QNPMMSENASVASLGPMPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAASMGPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQPGLNQFGQMS
MPQPPIGPRQTSPLQHHGQLAQPGTLNPPMGYGPRMQQPSSQSQFLPQTAFSTQGMNVTN
MPLAPSGGQAPVSQAQISGSSCPVNSPIMPPGSQGSHIHCPSLPQPALHQNSPSPVPSRT
PTPHHTPPSIGAQQPPAAGIPGPVPTPPAGPPGPQSQALHPPPRQTPTPPPTQLPPQVQP
SLPAAPPADPAQQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSS
TEVNSQTIPEKQPSQEVKMETKMEVDPPEPADTQPEEIPETKAEDCKVEPTETEERGTEL
KTETKEEEDQPSTSATQSPPVPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPV
DPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVY
KYCSKLSEVFEQEIDPVMQGLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYH
FCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICV
LHHEIIWPSGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESG
EVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQ
EYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACP
PSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAK
ELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKN
KSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLI
PCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVET
RWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNSQQAAATQSPGDSRRLSIQRCI
QSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQEN
KCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGPALPNAATHTTPT
GQQPTTPQTPQPQPPSQPQPTPPNSMPPYLPRTQATGPVSQGKAAGQVTPPTPPQTAQPP
LPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNPPPMARGPS
GHLEPGMGPTGMQQQPPWAQGGLPQPQQLQPGMPRPAMMSVSQHGQPLNMAPQPGLGQVG
VSPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNP
QPLPGQPGMPQGQPGLQPPTMPGQQGVHSSPAMQNMNPMQAGVPRAGLPQQQPQQQLQPP
MGGMSPQAQQMNMNHNAMPSQFRDILRRQQMMQQQQQGAGPGIGPGMANHNQFQQPQGVG
YPPQQQQQQQQRMQHHMQQIQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQ
PNPMSPQQHMLPSQAQSPHLQGQQIPSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQP
SPHHVSPQTSSPHPGLVAAQGNPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGL
STDNSDLNSNLSQSTLDIH
NT seq 7260 nt   +upstreamnt  +downstreamnt
atggccgagaatgtcgtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggctctctatttgacttggag
cacgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacag
ctgtcagaattgctacggtctggtagttcccctaacctcaatatgggggttggtggccca
ggccaaggcatggccagccagccccaacagaacagtcctggattaggtttgataaatagc
atggtcaaaagcccaatggcacaggcaggcttgacttctcccaacatggggatgggcact
agtggaccaaatcagggtcctgcaccatctgcaccaggtatgatgaacagtccagtaaat
caacctgccatgggaatgaacacagggatgaatgcgggcatgaatcctggaatgttgact
gcaggcaatggacaggggatgatgcctaatcaagtcatgaacggttcaattggagcaggc
cgggggcgacctaatatgcagtacccaaacccaggcatgggaagtgctggcaacttaatg
actgagccactgcagcaaggctctcctcagatgggaggacaaacaggattgagaggcccc
cagcctcttaagatgggaatgatgaacaacccaaatccttacagttcaccatatactcag
aattctggacagcagattggaaccagtggccttggtctccagattccaacaaagtctgtg
ctaccaaatagcttacctccgtttgcaatggacaaaaaggcagttcctggtggaggaatg
cccaacatgggccagcagcagtccccgcaggtccagcagccgggcctggtgactccggta
gcccaagggatgggttctggagcacacacggctgatccagagaagcgcaagctcatccag
cagcagcttgttctccttttgcacgctcacaagtgccagcgccgggagcaggctaatggg
gaagtgcggcagtgcaaccttccccactgtcggacaatgaagaatgtccttaaccacatg
acacactgccagtcaggcaagtcctgccaagtggcacactgtgcatcttctcgacaaatc
atttcacactggaagaattgtacaaggcatgattgccctgtgtgtctcccccttaagaat
gctggggataagagaaatcaacagtcaattctgactggagcaccagttggacttggaaat
actagctctctaggggtgggtcaacagtctactcccagcctaagcactgttagtcagatt
gatcccagctctatagaaagagcatatgcagcccttggactaccctatcaagtaaatcag
atgccgacacagccccaggtgcaagcaaagaaccagcagaaccagcagtcggggcagtct
cctcaagggatgcgacccatgagcaacatgagtgctagtcctatgggagtaaacggaggt
gtaggggttcaaacgtcaaatcttctttctgactcgatgttgcattcagccataaattct
caaaacccaatgatgagtgaaaatgccagtgtggcctccctgggtcctatgccaacagca
gctcaaccatccagtactggaattcggaaacagtggcatgaagatattactcaggatctt
cgaaatcatcttgttcacaaacttgttcaagccatatttcctactccggatcctgctgct
ttaaaagacaggcggatggaaaacctagttgcatatgcccggaaagtggaaggggacatg
tatgaatctgcaaataatcgagcggaatactaccacctgctagctgagaagatctataaa
atccagaaagaactagaagaaaaacgaaggactagactacagaaacagaacatgctacca
agtgctgcaagcatggggccagtttccatgaacccagggcctaacatgggacagccacaa
ccaggaatgacttcaaacggccctctacctgatccttctatgatccgtggcagtgtgcca
aaccagatgatgcctcggataactccacaacctggtttgaatcaatttggccagatgagc
atgcctcagccccctattggaccccggcaaacctctcctcttcagcaccatggacagtta
gctcaacctggaactctcaacccgcctatgggctatgggcctcgcatgcagcagccttcc
agccagagccagttccttccgcagactgcgttctcaacacagggaatgaatgtaacaaat
atgcctttggctccgtctggcggtcaagcaccagtgtctcaagcacaaatatccggttct
tcctgccctgtgaactctcctataatgcctcctggatctcaagggagccacattcactgt
ccctctctccctcagccagctctgcaccagaactcaccttctcctgtccctagtcgtacc
cccacccctcaccacactcccccaagcataggggctcagcagccaccagcagcaggaatt
ccaggccctgttcctacacctccagcagggccgcccgggccccagtcccaggctctgcac
ccacctccacgacagacacctacaccaccaccaacgcaacttcctccccaagtacagcct
tcacttcctgctgctcctccagctgacccggcacagcagcagcctctgtcacagcaaagt
accgcggcctctgttcccaccccgacggcgccactgctgccaccgcagccggccactccg
ctctcccagccagctgtaagcattgaagggcaggtatcaaaccctccatctactagtagc
acagaagtgaattctcagaccatccctgagaagcagccttcacaggaagtgaaaatggag
actaaaatggaagtggatccaccagaaccagcagatacacagccagaggagattccagag
actaaagcagaagactgtaaagtggaacctacagaaacagaagagagaggcactgaattg
aaaactgaaacaaaagaagaggaagaccagccaagtacttcagcgacccagtcacctcca
gtcccaggacagtcaaagaagaagattttcaaacctgaagagttaagacaggcactgatg
ccaacactggaggcactttatcgacaggatccagaatccctcccctttcgtcaacctgtg
gaccctcaacttctaggaatccctgattactttgatattgtgaagagccccatggatctt
tctaccatcaagaggaagttagacactggacagtatcaggagccctggcagtatgtggac
gacatttggcttatgttcaacaatgcctggttatataatcggaaaacatcacgggtatac
aaatactgctccaagttatctgaggtctttgaacaagaaattgacccagtgatgcagggc
cttggatactgttgtggcagaaagttggagttctctccacagacactctgttgctatggc
aaacagttatgcacaatccctcgcgatgccacttactacagttaccagaacaggtatcat
ttctgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgaccct
tcccagcctcaaactacaataaataaagaacaattttcgaagagaaaaaatgacacactg
gatcctgaactgtttgttgaatgtacagagtgtggaagaaagatgcatcagatctgtgtt
cttcatcatgagatcatctggccatctggatttgtctgtgatggctgtttaaagaaaact
gcacgaactagaaaagaaaataaattttctgctaaaaggttgccgtctactaggcttggc
acctttctggagaatcgtgtgaatgactttctgaggcgacagaatcaccctgagtctgga
gaggtcactgtgcgggtagttcatgcttctgacaaaactgtggaagtcaaaccaggcatg
aaagcaaggtttgtagatagtggagagatggcagaatcctttccatatcgaaccaaagcc
ctctttgccttcgaagagattgatggtgttgacctgtgtttcttcggcatgcacgtgcaa
gagtatggctccgactgccctccgcccaaccagaggagagtatacatatcatacctcgat
agtgttcatttcttccgtcctaaatgcttgaggactgcagtctatcatgaaattctaatt
ggatatttagaatacgtcaagaaactaggatatacaacagggcatatttgggcatgtccc
ccaagtgagggagacgactatatcttccattgccacccccctgaccagaagatacccaag
cccaagagactgcaggagtggtacaaaaagatgctggacaaggccgtgtccgagcgaatt
gtccatgactacaaggatatttttaaacaagctactgaggatcgattaacaagcgcgaag
gaattgccttactttgagggtgatttctggcccaatgttctggaagagagcattaaggaa
ctggagcaggaggaggaagagaggaagcgagaggagaacaccagcaatgagagcacagat
gtgacaaagggagacagcaagaatgctaaaaagaagaataataagaaaaccagcaaaaac
aagagtagcctgagcagaggcaataagaagaagccaggcatgcccaatgtgtccaatgat
ctctcgcaaaaactgtacgccaccatggagaagcacaaagaggtcttctttgtgatccgt
cttatcgccggccctgccgccaactccctgcctcccattgttgatcccgaccccctcatc
ccctgcgacctgatggatgggcgggatgccttcctcaccctcgccagggacaagcacctg
gagttctcttcactccgaagagcccagtggtccaccatgtgcatgctggtggagctgcac
actcagagccaggatcgcttcgtctacacctgcaatgagtgcaagcaccatgtagagacg
cgctggcactgcaccgtgtgcgaggattatgatttgtgtatcacttgctataacactaaa
aaccacgaccacaagatggagaaactaggtcttgggttggatgatgagagcaatagccag
caggccgcagccacccagagcccgggagactcccgccgcctgagcatccagcgctgcatc
cagtctctggtccacgcctgccagtgccgaaatgccaactgctccctgccctcctgccag
aagatgaagcgggtcgtgcagcacaccaagggctgcaagcggaagaccaatggagggtgc
cccatctgcaagcagctcatcgccctctgctgctaccatgccaagcactgccaggagaac
aagtgccctgtgcccttctgcctcaacatcaagcagaagcttcggcaacagcaactgcag
caccggctccagcaggcccagatgcttcgccggagaatggccagcatgcagcggactggc
gtggtggggcagcagcagggccctgccctccccaacgccgccactcacaccacaccgacg
ggccagcagcccaccaccccgcagacgccccagccccagcccccatcacagccccagccc
actccccccaacagcatgccgccctacttgcccaggactcaagccactggccctgtgtcc
cagggtaaggcagcaggacaggtgacccctccgacccctcctcagactgctcagccaccc
cttccaggacctccacctgctgcagtggaaatggcaatgcagattcagagggcggctgag
acgcagcgccagatggcccacgtgcaaattttccaaaggccaattcagcaccagatgccc
cagatgactccaatggcccccatgggcatgaatccgccccccatggccagagggcccagc
gggcatctggagccagggatggggcccacagggatgcagcagcaaccaccgtgggcccaa
ggagggttgcctcaaccccagcagctgcagcccggaatgccaaggccagccatgatgtca
gtgtcacagcatgggcagcccttgaacatggctccccagcccggactgggccaggtcggt
gtgagccctctcaaaccaggcactgtgtctcaacaagccttacaaaaccttttgcggact
ctcaggtctcccagctctcccctacagcagcaacaggtgcttagtatccttcacgccaac
ccccagttgttggcggcgttcatcaagcagcgggctgccaagtacgccaactctaacccg
cagcccctcccgggacagcctggcatgccccagggccaaccggggctgcagccacctacc
atgccaggccagcagggcgtccactccagtccagccatgcagaacatgaatcccatgcag
gcgggcgtcccgagggccggcctgccccagcagcaaccacagcagcagctccagccaccg
atgggagggatgagcccccaggctcagcagatgaacatgaatcacaacgccatgccttca
cagttccgagacatcttgagacgacagcagatgatgcagcagcagcaacagggcgcaggg
ccagggatcggccccgggatggccaaccacaaccagttccagcagccccagggagttggc
taccccccgcagcagcagcagcagcagcagcagcggatgcagcatcacatgcagcagata
cagcaggggaacatgggacagatgggccagctcccgcaggccctgggcgcagaggcagga
gccagtctgcaggcctatcagcagcgactccttcagcagcagatgggatcgccggctcag
cccaaccccatgagcccccagcagcacatgctcccaagtcaggcccagtccccacacctc
cagggccagcagattccttctctctccaaccaagtgcgttctcctcagcctgtcccttct
ccgcggccgcagtcccagcccccccactccagcccgtccccgaggatgcagcctcagcct
tctccacaccacgtttccccacagaccagttctccacatcctggactggtagctgcccag
ggcaaccccatggaacaagggcattttgccagcccggaccagaattcgatgctttctcag
ctcgctagcaacccaggcatggcaaacctccatggtgcaagcgccacggacctgggactt
agcaccgataactcagacttgaattcaaacctctcacagagtacactagacatacactag

KEGG   Camelus dromedarius (Arabian camel): 105099829
Entry
105099829         CDS       T04642                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk04024  cAMP signaling pathway
cdk04066  HIF-1 signaling pathway
cdk04068  FoxO signaling pathway
cdk04110  Cell cycle
cdk04310  Wnt signaling pathway
cdk04330  Notch signaling pathway
cdk04350  TGF-beta signaling pathway
cdk04520  Adherens junction
cdk04630  JAK-STAT signaling pathway
cdk04720  Long-term potentiation
cdk04916  Melanogenesis
cdk04919  Thyroid hormone signaling pathway
cdk04922  Glucagon signaling pathway
cdk04935  Growth hormone synthesis, secretion and action
cdk05016  Huntington disease
cdk05152  Tuberculosis
cdk05161  Hepatitis B
cdk05164  Influenza A
cdk05165  Human papillomavirus infection
cdk05166  Human T-cell leukemia virus 1 infection
cdk05167  Kaposi sarcoma-associated herpesvirus infection
cdk05200  Pathways in cancer
cdk05203  Viral carcinogenesis
cdk05206  MicroRNAs in cancer
cdk05211  Renal cell carcinoma
cdk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105099829 (CREBBP)
   04330 Notch signaling pathway
    105099829 (CREBBP)
   04350 TGF-beta signaling pathway
    105099829 (CREBBP)
   04630 JAK-STAT signaling pathway
    105099829 (CREBBP)
   04066 HIF-1 signaling pathway
    105099829 (CREBBP)
   04068 FoxO signaling pathway
    105099829 (CREBBP)
   04024 cAMP signaling pathway
    105099829 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105099829 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    105099829 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    105099829 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    105099829 (CREBBP)
   04919 Thyroid hormone signaling pathway
    105099829 (CREBBP)
   04916 Melanogenesis
    105099829 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    105099829 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105099829 (CREBBP)
   05206 MicroRNAs in cancer
    105099829 (CREBBP)
   05203 Viral carcinogenesis
    105099829 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    105099829 (CREBBP)
   05215 Prostate cancer
    105099829 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    105099829 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    105099829 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105099829 (CREBBP)
   05161 Hepatitis B
    105099829 (CREBBP)
   05164 Influenza A
    105099829 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105099829 (CREBBP)
   05165 Human papillomavirus infection
    105099829 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cdk03000]
    105099829 (CREBBP)
   03036 Chromosome and associated proteins [BR:cdk03036]
    105099829 (CREBBP)
   03029 Mitochondrial biogenesis [BR:cdk03029]
    105099829 (CREBBP)
Enzymes [BR:cdk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     105099829 (CREBBP)
Transcription factors [BR:cdk03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    105099829 (CREBBP)
Chromosome and associated proteins [BR:cdk03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    105099829 (CREBBP)
Mitochondrial biogenesis [BR:cdk03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    105099829 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 105099829
NCBI-ProteinID: XP_031303473
LinkDB
Position
Unknown
AA seq 2452 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLV
PDAASKHKQLSELLRGGSSSNINPGIGNVSASSPVQQGLGGQAQGQPNSANMAGLGAMGK
SPLNQGDSSAPTLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLA
ETLTQVSPQMTSHAGLNTAQAGGMTKMGMTGNTSPFGQPFNQTGGQQMGAPGVNPQLPSK
QSIVNSLPPFPADIKNASVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSS
MQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQ
QPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGTQPPGIPQAQPVRPPNGPMSLPVNRMQVSQG
MNSFNPMSLGNVQLPQAPMGPRSASPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGAHA
NNMMAQAPAQNQFLPQNQFPSSSGAMSVNSVGMGQPAAQAGVSQGQVPGAALPNPLNMLG
PQASQLPCPPVTQSPLHQTPPPASTAAGMPSLQHPAAPGMTPPQPAAPTQPSTPVSSSGQ
TPTPTPGSVPSASQTQSTPTVQAAAQAQVTTQPQTPVQPPSVATPQSSQQQPTPVHAQPP
GTPLSQAAASIDNRVPTPSSVASTETNSQQPGPDVPMLEMKAEVKTEDTEPDASEPKGEP
GSAMMEEDLQGSSQVKEETDPAEQKSEPMEVDEKKPEVKVEAKEEEESSANGTASQSTSP
SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLST
IKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
YCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQ
PQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGR
TRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKS
RFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSI
HFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPK
RLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELE
QEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPTMPNVSNDL
SQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWE
FSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKS
HTHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQK
MKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQH
RLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMS
PAGFPNVARTQPPTTVSTGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNI
NNGMPPGRTGMVTPVSQMAPVGLNVPRPNQVSGPVVPNLPPGQWQQAPIPQQQPMPGMPR
PVMSMQAQPAVAGPRMPSVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSNPQLM
AAFIKQRTAKYVASQPGLQPQPGLQAQPGLQPQPSLHQQPSLQNLNTMQAGGPRPGVPPQ
QQAMGGLNPQGQALNIMNPGHNPSMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQQQQ
QQQQQPPGGAGMAGGMAGHSQFQQPQGPGGYPPAMQQQRMQQHLPIQGSSMGQMAAQMGQ
LGQMGQPGLGADSAPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHL
PGQQMATSLSSQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVT
MASSIDQGHLGNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7359 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cccgatgagctgatccccaatggaggagaattaggccttttaaacagtgggaaccttgtt
ccagatgctgcttccaaacataaacaactgtcagagcttctgcgaggaggcagcagctct
aacatcaacccaggaataggaaatgtgagcgccagcagtcctgtgcagcaaggccttgga
ggccaggcccaagggcagccgaacagtgcgaatatggccggtctgggtgccatgggcaag
agccctctgaaccagggagattcttcagcccctaccctgcctaaacaggcagccagcacc
tccgggcccactccccctgcttcccaagcactgaatccgcaagcacaaaagcaagtgggg
ctggtgaccagcagccctgccacgtcacagacgggacctgggatctgcatgaatgctaac
tttaaccagacccatccaggcctcctcaatagcaactctggccatagtttgatgaaccag
gcccagcaagggcaggcgcaagtcatgaatggatctcttggggctgctggcagaggaagg
ggagccggaatgccataccctgctccggccatgcagggggccacgagcagcgtgctggcc
gagacattaacgcaggtttcgccgcaaatgaccagtcatgcaggactgaacacagctcag
gccggaggcatgaccaagatgggaatgactggtaacacaagtccgtttggacaacccttc
aatcaaactggagggcagcagatgggagcccctggagtgaaccctcagttacccagcaaa
cagagtatcgtcaatagcttgcctcccttccctgcagacatcaagaatgcttccgtcacc
aacgtgccaaacatgtctcagatgcaaacatctgtgggaattgtacccacacaggcaatt
gcaacgggccccactgcagatcccgaaaagcgcaaactgatacagcagcagctggttcta
ctgcttcacgctcataaatgtcagaggcgggaacaagccaatggagaggttcgggcctgc
tctctcccgcattgtcgaaccatgaaaaatgttttgaatcacatgacacattgtcaggct
gggaaagcctgtcaagttgcccattgtgcatcttcacgacaaatcatctctcattggaag
aactgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtcgccagctagtggaattcaaaacacaattggttctgtt
ggcacaggccaacagaatgccacttctttaagtaacccaaatcccatagaccccagctcc
atgcaacgagcgtatgctgctcttggactcccctacctgaaccagcctcagacccagctg
cagcctcaggttcctggccagcaaccagcacagcctcaaactcaccagcagatgaggact
ctgaaccccctgggaaataacccaatgaacattccagcaggaggaatcacaacagatcag
caaccaccaaacttgatttcagaatcagctcttccaacttccctcggggccacaaaccca
ctgatgaatgacggctccaactcgggcaacattggcaccctcagcactataccgacagca
gcacctccttccagcactggtgttcggaaaggctggcacgaacacgtcactcaggacctg
cggagccatctggtgcataaacttgtccaagccatcttcccgacacctgaccccgcagcc
ctgaaggaccggcgcatggagaacctggtggcctatgccaagaaagtggaaggggacatg
tatgagtccgccaacagcagggatgaatactatcacttattagcagagaaaatctacaag
atacaaaaggaactagaggaaaaacggaggtcgcgtttacacaaacaaggcatcttgggt
aaccagccagccttaccagcccccgggacgcagccccctgggataccacaggcacaacct
gtgagacctccgaatgggcccatgtccctgccagtgaatcgcatgcaggtttctcaaggg
atgaattcatttaacccaatgtccttggggaatgtacagttgccacaagctcccatggga
ccgcgttcagcgtcccccatgaaccactctgtcccgatgaacagcatgggctccgttcca
gggatggccatttctccttcccgaatgcctcagcctccgaacatgatgggtgcgcatgcc
aacaacatgatggcccaggcgcctgcacagaaccagttcctgccacagaaccagttcccg
tcatccagcggggcgatgagtgtgaacagtgtgggcatggggcagccggcggcgcaggcc
ggagtgtcacagggacaagtgcctggtgctgctcttcctaaccctctgaacatgcttggg
ccccaggccagccagctgccttgcccaccagtgacacagtcacctttgcatcagacgcca
cctcctgcttccacggccgcgggcatgccatctctccagcatccagcagcacctgggatg
actcctccccagccagcagctcccacccagccatcgactcctgtgtcgtcttccgggcag
acccctaccccgactcctggctcagtgcccagtgctagccaaacccagagcacccctacg
gtccaggcagcagcccaggcccaggtgacaacacagcctcagaccccagtccagcctccg
tccgtggccacccctcagtcgtcacagcagcagccgacacctgttcatgcccagccccct
ggcacaccgctttcccaggcagcagccagcattgataacagggtccccactccatcctca
gtggccagtaccgaaaccaactcccagcagccaggacctgacgtaccaatgctggaaatg
aaagctgaagtcaagaccgaggacaccgagcctgatgccagcgaacccaagggagagcct
gggtctgcgatgatggaggaggatttacaaggatcttctcaagttaaagaagaaacagac
ccagcagagcagaaatcggaaccaatggaagtggatgaaaagaaacctgaagtgaaagtc
gaagctaaagaggaagaagagagcagcgcaaatgggacggcctctcagtcaacttctcct
tcgcagcctcgcaaaaagatctttaagccggaggagttacgccaggctctgatgccaacc
ctagaagcactgtatcgacaggatccggagtccttaccttttcggcagcctgtagatccc
cagctcctaggaattccagattattttgacattgtgaagaatcccatggacctttccacc
atcaagcggaagctggatacagggcagtaccaggaaccctggcagtatgtggacgatgtc
tggctcatgttcaacaacgcctggctctataatcggaagacgtcccgggtctacaagttc
tgcagtaaactcgcagaggtctttgagcaagaaattgaccctgttatgcagtcccttgga
tattgctgtggacgcaagtatgagttttcccctcagactttgtgctgctacgggaagcag
ctgtgtacaattcctcgcgatgctgcgtactacagctatcagaacaggtatcatttctgt
gagaagtgtttcacagagatccagggggagaatgttaccctgggtgacgacccttcacaa
ccccagacgacaatttcaaaggatcagtttgaaaagaagaaaaatgataccttggatcct
gaacctttcgttgactgcaaggagtgtggccggaagatgcatcagatctgtgttctccac
tatgatatcatttggccttcaggctttgtgtgtgacaactgcttgaagaaaactggcagg
actcgaaaagaaaacaaattcagtgctaagagactgcagaccacacgattgggaaaccac
ttagaagaccgagtgaacaagtttttgcggcgacagaatcatcctgaagctggggaggtc
tttgtccgcgtggtggccagctcagacaagacggtggaggtcaagccggggatgaagtca
cggtttgtggattcaggggaaatgtctgaatctttcccatatcgaaccaaagcactcttt
gcctttgaggaaattgacggagtggatgtgtgcttctttgggatgcacgtccaggagtat
ggctctgactgcccccctccaaacacaaggcgtgtgtacatatcttatctggacagtatt
catttcttccgaccccgatgtctccgaacagccgtttaccatgagatccttattggatat
ttagagtatgtgaagaaattggggtatgtaacagggcacatctgggcctgtcccccaagt
gagggagacgactacatcttccactgccacccccctgatcagaaaatcccgaagccgaag
cgcctgcaggagtggtacaagaagatgttggacaaggccttcgccgagcggatcatccat
gactacaaggacattttcaaacaagcaactgaagataggcttaccagcgccaaggagctg
ccctattttgagggtgacttctggcccaacgtgctggaggagagcattaaggagctggag
caggaggaagaggagaggaagaaggaggagagcaccgcggccagcgagaccacggagggc
agccagggcgacagcaagaatgccaagaaaaagaacaacaagaaaaccaataagaataag
agcagcatcagccgagccaacaagaagaagcccaccatgcccaacgtgtccaacgacctg
tcccagaagctctacgccaccatggagaagcacaaagaggtcttctttgtgatccacctc
catgccggacctgtcatcaacacgctgccccccatcgttgaccccgaccccctgctcagc
tgtgacctcatggatgggcgggacgccttcctcaccctggccagggacaagcactgggag
ttctcctccctgcggcgctccaaatggtccacgctctgcatgctggtggagctgcacacc
cagggccaggaccgcttcgtctacacctgcaacgagtgcaagcaccatgtggagacgcgc
tggcactgcaccgtgtgtgaggactatgacctttgcatcaactgctacaacacaaagagc
cacacccacaagatggtgaagtgggggctgggcctggacgacgagggcagcagccaaggc
gagccccagtccaagagcccccaggagtcgcggcgcctgagcatccagcgctgcatccag
tccctggtgcacgcctgccagtgccgcaatgccaactgctcgctgccgtcctgccagaag
atgaagcgggtggtgcagcacaccaagggctgcaagcgcaagaccaacggcggatgcccg
gtgtgcaagcagctcattgccctctgctgctaccacgccaaacactgccaagaaaacaag
tgccccgtacccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcac
cgcctgcagcaggcccagctcatgcgccggcggatggccaccatgaacacccgcaacgtg
cctcagcagagcctgccttcccctacctcagcaccgcccgggacccccacacagcagccc
agcacgccccagacaccgcagcctcccgcccagccccagccctcacctgtcagcatgtca
ccagctggcttccccaacgtggcgcggactcagccccccacgacggtgtccaccgggaag
cccaccaaccaggtgccggccccgccgccccctgcccagcccccacccgcggcggtggag
gccgccaggcagatcgagcgggaagcccagcagcagcagcacctgtaccgggtgaacatc
aacaatggcatgcccccggggcgcacgggcatggtgaccccggtgagccagatggcccct
gtgggcctgaacgtgccccgacccaaccaggtcagtgggcccgtcgtgcccaacctgccg
cctgggcagtggcagcaagcgcccatcccccagcagcagccaatgccgggcatgccccgt
cctgtgatgtccatgcaggcccagccggctgtggccgggccacggatgcccagtgtgcag
ccaccccggagcatctcgcccggggccttgcaggacctgctgcggaccctgaagtcaccc
agctccccacagcagcagcagcaggtgctcaacatcctcaagtccaaccctcagctgatg
gcagctttcatcaaacagcgcacggccaagtacgtggccagccagcctggcctgcagccc
cagcctggcctccaggcccagcccggccttcagccccagcccagcctgcaccagcagccc
agcctgcagaacctgaacaccatgcaagccggcgggcctcggccgggcgtgcctccacag
cagcaggcaatgggtggcctcaacccccagggccaggccctgaacatcatgaacccgggg
cacaaccccagcatggcgagtatgaacccacagtaccgagagatgctgcgaaggcagctc
ctgcagcagcagcagcagcagcagcaacagcagcagcagcagcagcagcagcaacagcag
caacagcagcagcagccaccgggtggcgcaggcatggccgggggcatggcagggcacagc
cagttccagcagcctcaaggacccggaggctacccgccggccatgcagcagcagcggatg
cagcagcacctccccatccagggcagctccatgggccagatggcagctcagatgggacag
cttggccagatggggcagccggggctgggtgcagacagcgcccccaacatccagcaggcc
ctgcagcagcggattctgcagcagcagcagatgaagcagcagatcgggtccccaggccag
ccgaaccccatgagcccccagcagcacatgctctcaggacagccacaggcctcgcacctc
cccggccagcagatggccacgtcccttagtagccaggtgcggtctccggcccctgtccag
tctccacggccccagtcccagcctccacattccagcccgtcgccacggatacagccccag
ccttcaccgcaccatgtctcgccccagactggttctccccacccaggactcgcagtcacc
atggccagctccatagatcagggacacttggggaaccccgaacagagtgcaatgctcccc
cagctgaacacccccaacaggagtgcgttgtccagtgagctgtccctggtcggcgacacc
acaggagataccctagaaaagtttgtggagggtttgtag

DBGET integrated database retrieval system